Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (33.48kD).)

Mouse anti-Human Myostatin Monoclonal Antibody | anti-MSTN antibody

Myostatin (MSTN, Growth Differentiation Factor 8, Growth/Differentiation Factor 8, GDF8, GDF-8) (Biotin)

Gene Names
MSTN; GDF8; MSLHP
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Myostatin; Monoclonal Antibody; Myostatin (MSTN; Growth Differentiation Factor 8; Growth/Differentiation Factor 8; GDF8; GDF-8) (Biotin); anti-MSTN antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3E7
Specificity
Recognizes human GDF8.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-MSTN antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa243-310 from human GDF8 (NP_005250) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCS
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (33.48kD).)

Western Blot (WB) (Western Blot detection against Immunogen (33.48kD).)

Western Blot (WB)

(GDF8 monoclonal antibody, Western Blot analysis of GDF8 expression in LNCaP.)

Western Blot (WB) (GDF8 monoclonal antibody, Western Blot analysis of GDF8 expression in LNCaP.)

Western Blot (WB)

(Western Blot analysis of GDF8 expression in transfected 293T cell line by GDF8 monoclonal antibody. Lane 1: GDF8 transfected lysate (42.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GDF8 expression in transfected 293T cell line by GDF8 monoclonal antibody. Lane 1: GDF8 transfected lysate (42.8kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-MSTN antibody
GDF-8, also known as Myostatin, belongs to the TGF-beta superfamily. It is synthesized as an inactive proprotein with the N-terminal pro-region and the C-terminal mature bioactive region. The GDF-8 proregion is capable of associating with active GDF-8 with high affinity and is a potent GDF-8 antagonist.
Product Categories/Family for anti-MSTN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15.1 kDa (134aa)
NCBI Official Full Name
growth/differentiation factor 8 preproprotein
NCBI Official Synonym Full Names
myostatin
NCBI Official Symbol
MSTN
NCBI Official Synonym Symbols
GDF8; MSLHP
NCBI Protein Information
growth/differentiation factor 8
UniProt Protein Name
Growth/differentiation factor 8
UniProt Gene Name
MSTN
UniProt Synonym Gene Names
GDF8; GDF-8
UniProt Entry Name
GDF8_HUMAN

NCBI Description

This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein negatively regulates skeletal muscle cell proliferation and differentiation. Mutations in this gene are associated with increased skeletal muscle mass in humans and other mammals. [provided by RefSeq, Jul 2016]

Uniprot Description

MSTN: Acts specifically as a negative regulator of skeletal muscle growth. Defects in MSTN are the cause of muscle hypertrophy (MSLHP). MSLHP is a condition characterized by increased muscle bulk and strength. Affected individuals are exceptionally strong. Belongs to the TGF-beta family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 2q32.2

Cellular Component: extracellular space

Molecular Function: cytokine activity; identical protein binding; protein binding; receptor binding; transforming growth factor beta receptor binding

Biological Process: cell development; muscle development; muscle maintenance; negative regulation of myoblast differentiation; negative regulation of protein kinase B signaling cascade; negative regulation of skeletal muscle growth; positive regulation of transcription, DNA-dependent; regulation of apoptosis; regulation of MAPKKK cascade

Disease: Muscle Hypertrophy

Research Articles on MSTN

Similar Products

Product Notes

The MSTN mstn (Catalog #AAA6143070) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Myostatin (MSTN, Growth Differentiation Factor 8, Growth/Differentiation Factor 8, GDF8, GDF-8) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Myostatin can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MSTN mstn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Myostatin, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.