Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human MYO3B Monoclonal Antibody | anti-MYO3B antibody

MYO3B (Myosin-IIIb)

Reactivity
Human
Applications
ELISA
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
MYO3B; Monoclonal Antibody; MYO3B (Myosin-IIIb); Anti -MYO3B (Myosin-IIIb); anti-MYO3B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1D1
Specificity
Recognizes human MYO3B.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
RRPSVTHLLDHPFIKGVHGKVLFLQKQLAKVLQDQKHQNPVAKTRHERMHTRRPYHVEDAEKYCLEDDLVNLEVLDEDTIIHQLQKRYAD
Applicable Applications for anti-MYO3B antibody
ELISA (EL/EIA)
Application Notes
Suitable for use in ELISA.
Immunogen
Partial recombinant protein corresponding to aa280-370 from human MYO3B (NP_620482) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Related Product Information for anti-MYO3B antibody
Probable actin-based motor with a protein kinase activity.
Product Categories/Family for anti-MYO3B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
151,829 Da
NCBI Official Full Name
myosin-IIIb isoform 2
NCBI Official Synonym Full Names
myosin IIIB
NCBI Official Symbol
MYO3B
NCBI Protein Information
myosin-IIIb
UniProt Protein Name
Myosin-IIIb
Protein Family
UniProt Gene Name
MYO3B
UniProt Entry Name
MYO3B_HUMAN

NCBI Description

This gene encodes one of the class III myosins. Myosins are ATPases, activated by actin, that move along actin filaments in the cell. This class of myosins are characterized by an amino-terminal kinase domain and shown to be present in photoreceptors. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2014]

Uniprot Description

MYO3B: an actin-based motor protein with protein kinase activity. A member of the myosin superfamily. Has a kinase domain of the STE20 family N-terminal to the conserved N-terminal motor domain. Expressed in retina, kidney and testis. Six alternatively spliced human isoforms have been described.

Protein type: Protein kinase, Ser/Thr (non-receptor); Actin-binding; Protein kinase, STE; Kinase, protein; EC 2.7.11.1; Motor; STE group; STE20 family; NinaC subfamily

Chromosomal Location of Human Ortholog: 2q31.1-q31.2

Cellular Component: filopodium tip; photoreceptor outer segment; photoreceptor inner segment; cytoplasm; stereocilium bundle tip; myosin complex

Molecular Function: microfilament motor activity; protein serine/threonine kinase activity; actin binding; ATP binding

Biological Process: positive regulation of filopodium formation; peptidyl-serine phosphorylation; visual perception; protein amino acid autophosphorylation; response to stimulus; peptidyl-threonine phosphorylation

Research Articles on MYO3B

Similar Products

Product Notes

The MYO3B myo3b (Catalog #AAA6011725) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MYO3B (Myosin-IIIb) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MYO3B can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA). Suitable for use in ELISA. Researchers should empirically determine the suitability of the MYO3B myo3b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RRPSVTHLLD HPFIKGVHGK VLFLQKQLAK VLQDQKHQNP VAKTRHERMH TRRPYHVEDA EKYCLEDDLV NLEVLDEDTI IHQLQKRYAD. It is sometimes possible for the material contained within the vial of "MYO3B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.