Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged MYCN is approximately 1ng/ml as a capture antibody.)

Mouse MYCN Monoclonal Antibody | anti-MYCN antibody

MYCN (V-myc Myelocytomatosis Viral Related Oncogene, Neuroblastoma Derived (avian), MODED, N-myc, NMYC, ODED, bHLHe37) (PE)

Gene Names
MYCN; NMYC; ODED; MODED; N-myc; bHLHe37
Applications
Western Blot
Purity
Purified
Synonyms
MYCN; Monoclonal Antibody; MYCN (V-myc Myelocytomatosis Viral Related Oncogene; Neuroblastoma Derived (avian); MODED; N-myc; NMYC; ODED; bHLHe37) (PE); V-myc Myelocytomatosis Viral Related Oncogene; bHLHe37; anti-MYCN antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4H4
Specificity
Recognizes MYCN.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-MYCN antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
MYCN (NP_005369, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MPSCSTSTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWKKFELLPTPPLSPSRGFAEHSSEPPSWVTEMLLENELWGSPAEEDAFGLG
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged MYCN is approximately 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MYCN is approximately 1ng/ml as a capture antibody.)
Related Product Information for anti-MYCN antibody
This gene is a member of the MYC family and encodes a protein with a basic helix-loop-helix (bHLH) domain. This protein is located in the nucleus and must dimerize with another bHLH protein in order to bind DNA. Amplification of this gene is associated with a variety of tumors, most notably neuroblastomas. [provided by RefSeq]
Product Categories/Family for anti-MYCN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
N-myc proto-oncogene protein isoform 1
NCBI Official Synonym Full Names
MYCN proto-oncogene, bHLH transcription factor
NCBI Official Symbol
MYCN
NCBI Official Synonym Symbols
NMYC; ODED; MODED; N-myc; bHLHe37
NCBI Protein Information
N-myc proto-oncogene protein
UniProt Protein Name
N-myc proto-oncogene protein
Protein Family
UniProt Gene Name
MYCN
UniProt Synonym Gene Names
BHLHE37; NMYC; bHLHe37
UniProt Entry Name
MYCN_HUMAN

NCBI Description

This gene is a member of the MYC family and encodes a protein with a basic helix-loop-helix (bHLH) domain. This protein is located in the nucleus and must dimerize with another bHLH protein in order to bind DNA. Amplification of this gene is associated with a variety of tumors, most notably neuroblastomas. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2014]

Uniprot Description

N-Myc: a proto-oncogenic transcription factor. Plays a role in cell proliferation, apoptosis and in the development of human tumors.

Protein type: Oncoprotein; DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 2p24.3

Cellular Component: nucleus; chromatin

Molecular Function: protein dimerization activity; protein binding; DNA binding; transcription factor activity

Biological Process: regulation of transcription from RNA polymerase II promoter; branching morphogenesis of a tube; negative regulation of astrocyte differentiation; positive regulation of mesenchymal cell proliferation; positive regulation of transcription from RNA polymerase II promoter; embryonic digit morphogenesis; embryonic skeletal morphogenesis; cartilage condensation; lung development

Disease: Feingold Syndrome 1; Tracheoesophageal Fistula With Or Without Esophageal Atresia

Research Articles on MYCN

Similar Products

Product Notes

The MYCN mycn (Catalog #AAA6186144) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's MYCN can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MYCN mycn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MYCN, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.