Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to MXD1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 6ug/ml])

Mouse anti-Human MXD1 Monoclonal Antibody | anti-MXD1 antibody

MXD1 (Max Dimerization Protein 1, Max Dimerizer 1, Protein MAD, MAD, MGC104659) (PE)

Gene Names
MXD1; MAD; MAD1; BHLHC58; MGC104659
Reactivity
Human
Applications
ELISA, Immunohistochemistry
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MXD1; Monoclonal Antibody; MXD1 (Max Dimerization Protein 1; Max Dimerizer 1; Protein MAD; MAD; MGC104659) (PE); anti-MXD1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2G10
Specificity
Recognizes human MXD1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-MXD1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin
Application Notes
IHC-P: 6ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa60-149 from human MXD1 (NP_002348) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
THNEMEKNRRAHLRLCLEKLKGLVPLGPESSRHTTLSLLTKAKLHIKKLEDCDRKAVHQIDQLQREQRHLKRQLEKLGIERIRMDSIGST
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to MXD1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 6ug/ml])

Testing Data (Immunoperoxidase of monoclonal antibody to MXD1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 6ug/ml])
Product Categories/Family for anti-MXD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,254 Da
NCBI Official Full Name
max dimerization protein 1 isoform 1
NCBI Official Synonym Full Names
MAX dimerization protein 1
NCBI Official Symbol
MXD1
NCBI Official Synonym Symbols
MAD; MAD1; BHLHC58; MGC104659
NCBI Protein Information
max dimerization protein 1; max dimerizer 1; OTTHUMP00000160049; MAX-binding protein; antagonizer of myc transcriptional activity
UniProt Protein Name
Max dimerization protein 1
Protein Family
UniProt Gene Name
MXD1
UniProt Synonym Gene Names
MAD; Max dimerizer 1
UniProt Entry Name
MAD1_HUMAN

NCBI Description

This gene encodes a member of the MYC/MAX/MAD network of basic helix-loop-helix leucine zipper transcription factors. The MYC/MAX/MAD transcription factors mediate cellular proliferation, differentiation and apoptosis. The encoded protein antagonizes MYC-mediated transcriptional activation of target genes by competing for the binding partner MAX and recruiting repressor complexes containing histone deacetylases. Mutations in this gene may play a role in acute leukemia, and the encoded protein is a potential tumor suppressor. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq]

Uniprot Description

Mad1: Transcriptional repressor. MAD binds with MAX to form a sequence-specific DNA-binding protein complex which recognizes the core sequence 5'-CAC[GA]TG-3'. MAD thus antagonizes MYC transcriptional activity by competing for MAX. Efficient DNA binding requires dimerization with another bHLH protein. Binds DNA as a heterodimer with MAX. Interacts with RNF17. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 2p13-p12

Cellular Component: nucleus

Molecular Function: protein dimerization activity; transcription cofactor activity; transcription corepressor activity; transcription factor activity

Biological Process: cell proliferation; transcription, DNA-dependent; multicellular organismal development; negative regulation of transcription from RNA polymerase II promoter

Research Articles on MXD1

Similar Products

Product Notes

The MXD1 mxd1 (Catalog #AAA6158950) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MXD1 (Max Dimerization Protein 1, Max Dimerizer 1, Protein MAD, MAD, MGC104659) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MXD1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin. IHC-P: 6ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MXD1 mxd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MXD1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.