Western Blot (WB)
(Western Blot detection against Immunogen (39.09kD).)
Mouse anti-Human MTPN Monoclonal Antibody | anti-MTPN antibody
MTPN (Myotrophin, FLJ31098, FLJ99857) APC
Gene Names
MTPN; V-1; GCDP
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MTPN; Monoclonal Antibody; MTPN (Myotrophin; FLJ31098; FLJ99857) APC; anti-MTPN antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F3
Specificity
Recognizes human MTPN.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
780
Applicable Applications for anti-MTPN antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant protein corresponding to aa1-119 from human MTPN (AAH28093) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MCDKEFMWALKNGGLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (39.09kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (39.09kD).)
Western Blot (WB)
(Western Blot analysis of MTPN expression in transfected 293T cell line by MTPN monoclonal antibody. Lane 1: MTPN transfected lysate (12.9kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of MTPN expression in transfected 293T cell line by MTPN monoclonal antibody. Lane 1: MTPN transfected lysate (12.9kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-MTPN antibody
Potential role in cerebellar morphogenesis. May function in differentiation of cerebellar neurons, particularly of granule cells. Seems to be associated with cardiac hypertrophy.
Product Categories/Family for anti-MTPN antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens myotrophin, mRNA
NCBI Official Synonym Full Names
myotrophin
NCBI Official Symbol
MTPN
NCBI Official Synonym Symbols
V-1; GCDP
NCBI Protein Information
myotrophin
Protein Family
NCBI Description
The transcript produced from this gene is bi-cistronic and can encode both myotrophin and leucine zipper protein 6. The myotrophin protein is associated with cardiac hypertrophy, where it is involved in the conversion of NFkappa B p50-p65 heterodimers to p50-p50 and p65-p65 homodimers. This protein also has a potential function in cerebellar morphogenesis, and it may be involved in the differentiation of cerebellar neurons, particularly of granule cells. A cryptic ORF at the 3' end of this transcript uses a novel internal ribosome entry site and a non-AUG translation initiation codon to produce leucine zipper protein 6, a 6.4 kDa tumor antigen that is associated with myeloproliferative disease. [provided by RefSeq, Jul 2008]
Research Articles on MTPN
Similar Products
Product Notes
The MTPN (Catalog #AAA6137724) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MTPN (Myotrophin, FLJ31098, FLJ99857) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MTPN can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MTPN for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MTPN, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
