Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human MSX2 Monoclonal Antibody | anti-MSX2 antibody

MSX2 (Homeobox Protein MSX-2, Homeobox Protein Hox-8, HOX8) APC

Gene Names
MSX2; FPP; MSH; PFM; CRS2; HOX8; PFM1
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MSX2; Monoclonal Antibody; MSX2 (Homeobox Protein MSX-2; Homeobox Protein Hox-8; HOX8) APC; anti-MSX2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F6
Specificity
Recognizes human MSX2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-MSX2 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa101-201 from human MSX2 (NP_002440) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TASVKSENSEDGAAWMQEPGRYSPPPRHMSPTTCTLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRL
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to MSX2 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.5ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to MSX2 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.5ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MSX2 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to MSX2 on HeLa cell. [antibody concentration 10ug/ml])
Product Categories/Family for anti-MSX2 antibody
References
1. Establishment of human dental epithelial cell lines expressing ameloblastin and enamelin by transfection of hTERT and cdk4 cDNAs. Hatakeyama S, Mizusawa N, Tsutsumi R, Yoshimoto K, Mizuki H, Yasumoto S, Sato S, Takeda Y.J Oral Pathol Med. 2010 Oct 4. doi: 10.1111/j.1600-0714.2010.00950.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
homeobox protein MSX-2 isoform 1
NCBI Official Synonym Full Names
msh homeobox 2
NCBI Official Symbol
MSX2
NCBI Official Synonym Symbols
FPP; MSH; PFM; CRS2; HOX8; PFM1
NCBI Protein Information
homeobox protein MSX-2
UniProt Protein Name
Homeobox protein MSX-2
Protein Family
UniProt Gene Name
MSX2
UniProt Synonym Gene Names
HOX8
UniProt Entry Name
MSX2_HUMAN

NCBI Description

This gene encodes a member of the muscle segment homeobox gene family. The encoded protein is a transcriptional repressor whose normal activity may establish a balance between survival and apoptosis of neural crest-derived cells required for proper craniofacial morphogenesis. The encoded protein may also have a role in promoting cell growth under certain conditions and may be an important target for the RAS signaling pathways. Mutations in this gene are associated with parietal foramina 1 and craniosynostosis type 2. [provided by RefSeq, Jul 2008]

Uniprot Description

MSX2: Acts as a transcriptional regulator in bone development. Represses the ALPL promoter activity and antogonizes the stimulatory effect of DLX5 on ALPL expression during osteoblast differentiation. Probable morphogenetic role. May play a role in limb-pattern formation. In osteoblasts, suppresses transcription driven by the osteocalcin FGF response element (OCFRE). Binds to the homeodomain-response element of the ALPL promoter. Defects in MSX2 are the cause of parietal foramina 1 (PFM1); also known as foramina parietalia permagna (FPP). PFM1 is an autosomal dominant disease characterized by oval defects of the parietal bones caused by deficient ossification around the parietal notch, which is normally obliterated during the fifth fetal month. Defects in MSX2 are the cause of parietal foramina with cleidocranial dysplasia (PFMCCD); also known as cleidocranial dysplasia with parietal foramina. PFMCCD combines skull defects in the form of enlarged parietal foramina and deficient ossification of the clavicles. Defects in MSX2 are the cause of craniosynostosis type 2 (CRS2); also known as craniosynostosis Boston-type (CSB). CRS2 is an autosomal dominant disorder characterized by the premature fusion of calvarial sutures. The craniosynostosis phenotype is either fronto-orbital recession, or frontal bossing, or turribrachycephaly, or cloverleaf skull. Associated features include severe headache, high incidence of visual problems (myopia or hyperopia), and short first metatarsals. Intelligence is normal. Belongs to the Msh homeobox family.

Protein type: DNA-binding; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 5q35.2

Cellular Component: transcription factor complex; nucleus

Molecular Function: protein binding; sequence-specific DNA binding; transcription cofactor activity; transcription factor binding

Biological Process: embryonic forelimb morphogenesis; transcription from RNA polymerase II promoter; negative regulation of keratinocyte differentiation; negative regulation of transcription from RNA polymerase II promoter; chondrocyte development; negative regulation of fat cell differentiation; positive regulation of catagen; embryonic hindlimb morphogenesis; osteoblast development; osteoblast differentiation; anterior/posterior pattern formation; negative regulation of cell proliferation; positive regulation of osteoblast differentiation; inhibition of CREB transcription factor; negative regulation of transcription, DNA-dependent; positive regulation of BMP signaling pathway; wound healing, spreading of epidermal cells; negative regulation of apoptosis

Disease: Parietal Foramina; Parietal Foramina With Cleidocranial Dysplasia; Craniosynostosis 2

Research Articles on MSX2

Similar Products

Product Notes

The MSX2 msx2 (Catalog #AAA6137708) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MSX2 (Homeobox Protein MSX-2, Homeobox Protein Hox-8, HOX8) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MSX2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MSX2 msx2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MSX2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.