Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human MSL2 Monoclonal Antibody | anti-MSL2 antibody

MSL2 (KIAA1585, MSL2L1, RNF184, Male-specific Lethal 2 Homolog, Male-specific Lethal 2-like 1, Male-specific Lethal-2 Homolog 1, RING Finger Protein 184) (MaxLight 405)

Gene Names
MSL2; MSL-2; MSL2L1; RNF184
Reactivity
Human
Applications
FLISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MSL2; Monoclonal Antibody; MSL2 (KIAA1585; MSL2L1; RNF184; Male-specific Lethal 2 Homolog; Male-specific Lethal 2-like 1; Male-specific Lethal-2 Homolog 1; RING Finger Protein 184) (MaxLight 405); anti-MSL2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3A4
Specificity
Recognizes human RNF184.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-MSL2 antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa478-576 from human RNF184 (NP_060603) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GQRCPCYSNRKACLDCICRGCQNSYMANGEKKLEAFAVPEKALEQTRLTLGINVTSIAVRNASTSTSVINVTGSPVTTFLAASTHDDKSLDEAIDMRF
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-MSL2 antibody
Component of histone acetyltransferase complex responsible for the majority of histone H4 acetylation at lysine 16 which is implicated in the formation of higher-order chromatin structure.
Product Categories/Family for anti-MSL2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase MSL2 isoform 1
NCBI Official Synonym Full Names
MSL complex subunit 2
NCBI Official Symbol
MSL2
NCBI Official Synonym Symbols
MSL-2; MSL2L1; RNF184
NCBI Protein Information
E3 ubiquitin-protein ligase MSL2
UniProt Protein Name
E3 ubiquitin-protein ligase MSL2
UniProt Gene Name
MSL2
UniProt Synonym Gene Names
KIAA1585; MSL2L1; RNF184; MSL2-like 1; MSL-2
UniProt Entry Name
MSL2_HUMAN

Research Articles on MSL2

Similar Products

Product Notes

The MSL2 msl2 (Catalog #AAA6191264) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MSL2 (KIAA1585, MSL2L1, RNF184, Male-specific Lethal 2 Homolog, Male-specific Lethal 2-like 1, Male-specific Lethal-2 Homolog 1, RING Finger Protein 184) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MSL2 can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MSL2 msl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MSL2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.