Testing Data
(Detection limit for recombinant GST tagged MSL2 is 0.1ng/ml as a capture antibody.)
Mouse anti-Human MSL2 Monoclonal Antibody | anti-MSL2 antibody
MSL2 (KIAA1585, MSL2L1, RNF184, Male-specific Lethal 2 Homolog, Male-specific Lethal 2-like 1, Male-specific Lethal-2 Homolog 1, RING Finger Protein 184)
Reactivity
Human
Applications
ELISA
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
MSL2; Monoclonal Antibody; MSL2 (KIAA1585; MSL2L1; RNF184; Male-specific Lethal 2 Homolog; Male-specific Lethal 2-like 1; Male-specific Lethal-2 Homolog 1; RING Finger Protein 184); Anti -MSL2 (KIAA1585; anti-MSL2 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3A4
Specificity
Recognizes human RNF184.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
GQRCPCYSNRKACLDCICRGCQNSYMANGEKKLEAFAVPEKALEQTRLTLGINVTSIAVRNASTSTSVINVTGSPVTTFLAASTHDDKSLDEAIDMRF
Applicable Applications for anti-MSL2 antibody
ELISA (EL/EIA)
Application Notes
Suitable for use in ELISA.
Immunogen
Partial recombinant corresponding to aa478-576 from human RNF184 (NP_060603) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged MSL2 is 0.1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged MSL2 is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-MSL2 antibody
Component of histone acetyltransferase complex responsible for the majority of histone H4 acetylation at lysine 16 which is implicated in the formation of higher-order chromatin structure.
Product Categories/Family for anti-MSL2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
MSL2 protein
NCBI Official Symbol
MSL2
NCBI Protein Information
MSL2 protein
Protein Family
Similar Products
Product Notes
The MSL2 (Catalog #AAA646007) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MSL2 (KIAA1585, MSL2L1, RNF184, Male-specific Lethal 2 Homolog, Male-specific Lethal 2-like 1, Male-specific Lethal-2 Homolog 1, RING Finger Protein 184) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MSL2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA). Suitable for use in ELISA. Researchers should empirically determine the suitability of the MSL2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GQRCPCYSNR KACLDCICRG CQNSYMANGE KKLEAFAVPE KALEQTRLTL GINVTSIAVR NASTSTSVIN VTGSPVTTFL AASTHDDKSL DEAIDMRF. It is sometimes possible for the material contained within the vial of "MSL2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
