Mouse anti-Human MSH2 Monoclonal Antibody | anti-MSH2 antibody

MSH2 (DNA Mismatch Repair Protein Msh2, hMSH2, MutS Protein Homolog 2) APC

Cat. Num. AAA6137698

• Gene Names: MSH2; FCC1; COCA1; HNPCC; LCFS2; HNPCC1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MSH2; Monoclonal Antibody; MSH2 (DNA Mismatch Repair Protein Msh2; hMSH2; MutS Protein Homolog 2) APC; anti-MSH2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4B2
• Specificity: Recognizes human MSH2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-MSH2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa835-934 from human MSH2 (AAH21566) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: NFPKHVIECAKQKALELEEFQYIGESQGYDIMEPAAKKCYLEREQGEKIIQEFLSKVKQMPFTEMSEENITIKLKQLKAEVIAKNNSFVNEIISRIKVTT
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Testing Data

(Detection limit for recombinant GST tagged MSH2 is 1ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis of protein-protein interactions between MAX and MSH2 HeLa cells were stained with anti-MAX rabbit purified polyclonal 1:1200 and anti-MSH2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Related Product Information for anti-MSH2 antibody

MSH2 is a member of the highly conserved families of postreplication mismatch repair genes, MutS and MaiL, involved in increasing the fidelity of replication by specific repair of DNA polymerase misincorporation errors. It is the human homolog of the bacterial MutS and S. cerevisiae MSH proteins. It maps to human chromosome 2p22-21 near a locus implicated in hereditary nonpolyposis colon cancer (HNPCC) and thus is the HNPCC gene. Defects in MSH2 accounts for most cases of sporadic colorectal tumors. Due to other functions besides its role in DNA repair, that include regulation of cell proliferation and apoptosis, it has recently been shown to be of importance for pathogenesis and progression of cancer. It is ubiquitously expressed.

Product Categories/Family for anti-MSH2 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 18204305
• NCBI GeneID: 4436
• Molecular Weight: 97,323 Da
• NCBI Official Full Name: Homo sapiens mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli), mRNA
• NCBI Official Synonym Full Names: mutS homolog 2
• NCBI Official Symbol: MSH2
• NCBI Official Synonym Symbols: FCC1; COCA1; HNPCC; LCFS2; HNPCC1
• NCBI Protein Information: DNA mismatch repair protein Msh2
• Protein Family: DNA mismatch repair protein

NCBI Description

This locus is frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). When cloned, it was discovered to be a human homolog of the E. coli mismatch repair gene mutS, consistent with the characteristic alterations in microsatellite sequences (RER+ phenotype) found in HNPCC. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2012]