CD109 recombinant protein

CD109 Recombinant Protein

Cat. Num. AAA3003425

• Gene Names: CD109; CPAMD7; RP11-525G3.1
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Synonyms: CD109; CD109 Recombinant Protein; CD109 recombinant protein

• Host: E Coli
• Purity/Purification: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Form/Format: PBS, 4M Urea, PH7.4
• Concentration: >=0.5mg/ml (varies by lot)
• Sequence: LSSVGSPKAKEALNMLTWRAEQEGGMQFWVSSESKLSDSWQPRSLDIEVAAYALLSHFLQFQTSEGIPIMRWLSRQRNSLGGFASTQDTTVALKALSEFAALMNTERTNIQVTVTGPSSPSPVKFLIDTHNRLLLQTAELAVVQPTAVNISANGFGFAICQLNVVYNVKASGSSRRRRSIQNQEAFDLDVAVKENKDDLNHVDLNVCTSFSGPGRSGMALMEVNLLSGFMVPSEAISLSETVKKVEYDHGKLNLYLDSVNETQFCVNIPAVRNFKVSNTQDASVSIVDYYEPRRQAVRSYNSEVKLSSCDLCSDVQGCRPCEDGA

• Tag: His-tag in C-terminal
• Expression Vector: pet-22b(+)
• BP: 987
• Restriction Site: NdeI-XhoI
• Preparation and Storage: Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Related Product Information for CD109 recombinant protein

Background: CD109 is a glycosylphosphatidylinositol (GPI)-linked glycoprotein that belongs to the alpha2-macroglobulin family of thioester containing proteins. CD109 is associated with TGF-beta receptor I (TbRI) and inhibits TGF-beta signaling. Cleavage of CD109 at its Furin cleavage site results in the release of its large amino-terminal domain, which then binds to the TGF-beta receptor I to inhibit TGF-beta signaling. CD109 is expressed on a subset of CD34+ bone marrow cells and mesenchymal stem cells, activated platelets, activated T cells, endothelial cells, and a wide variety of tumors. Elevated CD109 expression has been considered a test/prognostic marker for several types of cancers.

NCBI and Uniprot Product Information

• NCBI GI #: 227430303
• NCBI GeneID: 135228
• NCBI Accession #: NP_001153060.1
• NCBI GenBank Nucleotide #: NM_001159588.1
• UniProt Accession #: Q6YHK3; Q0P6K7; Q5SYA8; Q5XUM7; Q5XUM9; Q6MZI7; Q8N3A7; Q8N915; Q8TDJ2; A5YKK4; B2R948; B3KW25
• Molecular Weight: 161,689 Da
• NCBI Official Full Name: CD109 antigen isoform 3
• NCBI Official Synonym Full Names: CD109 molecule
• NCBI Official Symbol: CD109
• NCBI Official Synonym Symbols: CPAMD7; RP11-525G3.1
• NCBI Protein Information: CD109 antigen; p180; r150; Gov platelet alloantigens; activated T-cell marker CD109; platelet-specific Gov antigen; 150 kDa TGF-beta-1-binding protein; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 7
• UniProt Protein Name: CD109 antigen
• Protein Family: CD109 antigen
• UniProt Gene Name: CD109
• UniProt Synonym Gene Names: CPAMD7
• UniProt Entry Name: CD109_HUMAN

NCBI Description

This gene encodes a member of the alpha2-macroglobulin/complement superfamily. The encoded GPI-linked glycoprotein is found on the cell surface of platelets, activated T-cells, and endothelial cells. The protein binds to and negatively regulates signaling of transforming growth factor beta (TGF-beta). Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Apr 2009]

Uniprot Description

CD109: Modulates negatively TGFB1 signaling in keratinocytes. Belongs to the protease inhibitor I39 (alpha-2- macroglobulin) family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, GPI anchor

Chromosomal Location of Human Ortholog: 6q13

Cellular Component: extracellular space; cell surface; plasma membrane

Molecular Function: serine-type endopeptidase inhibitor activity; transforming growth factor beta binding

Biological Process: hair follicle development; negative regulation of protein amino acid phosphorylation; negative regulation of transforming growth factor beta receptor signaling pathway; regulation of keratinocyte differentiation