Testing Data
(Detection limit for recombinant GST tagged MRLC2 is 0.03ng/ml as a capture antibody.)
Mouse anti-Human MRLC2 Monoclonal Antibody | anti-MRLC2 antibody
MRLC2 (MYL12B, MYLC2B, Myosin Regulatory Light Chain 12B, MLC-2A, Myosin Regulatory Light Chain 2-B, Smooth Muscle Isoform, Myosin Regulatory Light Chain 20kD, Myosin Regulatory Light Chain MRLC2, SHUJUN-1) (AP)
Gene Names
MYL12B; MLC-B; MRLC2
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MRLC2; Monoclonal Antibody; MRLC2 (MYL12B; MYLC2B; Myosin Regulatory Light Chain 12B; MLC-2A; Myosin Regulatory Light Chain 2-B; Smooth Muscle Isoform; Myosin Regulatory Light Chain 20kD; Myosin Regulatory Light Chain MRLC2; SHUJUN-1) (AP); anti-MRLC2 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1B22
Specificity
Recognizes human MRLC2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-MRLC2 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa73-173 from human MRLC2 (NP_291024) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged MRLC2 is 0.03ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged MRLC2 is 0.03ng/ml as a capture antibody.)
Related Product Information for anti-MRLC2 antibody
The activity of nonmuscle myosin II (see MYH9; MIM 160775) is regulated by phosphorylation of a regulatory light chain, such as MRLC2. This phosphorylation results in higher MgATPase activity and the assembly of myosin II filaments (Iwasaki et al., 2001 [PubMed 11942626]).
Product Categories/Family for anti-MRLC2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
19,779 Da
NCBI Official Full Name
Homo sapiens myosin, light chain 12B, regulatory (MYL12B), transcript variant 2, mRNA
NCBI Official Synonym Full Names
myosin, light chain 12B, regulatory
NCBI Official Symbol
MYL12B
NCBI Official Synonym Symbols
MLC-B; MRLC2
NCBI Protein Information
myosin regulatory light chain 12B; MLC-2; MLC-2A; MLC20; SHUJUN-1; myosin regulatory light chain 2; myosin regulatory light chain 2-B, smooth muscle isoform; myosin regulatory light chain 20 kDa; myosin regulatory light chain MRLC2
NCBI Description
The activity of nonmuscle myosin II (see MYH9; MIM 160775) is regulated by phosphorylation of a regulatory light chain, such as MRLC2. This phosphorylation results in higher MgATPase activity and the assembly of myosin II filaments (Iwasaki et al., 2001 [PubMed 11942626]).[supplied by OMIM, Mar 2008]
Research Articles on MRLC2
Similar Products
Product Notes
The MRLC2 (Catalog #AAA6132375) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MRLC2 (MYL12B, MYLC2B, Myosin Regulatory Light Chain 12B, MLC-2A, Myosin Regulatory Light Chain 2-B, Smooth Muscle Isoform, Myosin Regulatory Light Chain 20kD, Myosin Regulatory Light Chain MRLC2, SHUJUN-1) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MRLC2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MRLC2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MRLC2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
