Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (49.65kD).)

Mouse anti-Human MREG Monoclonal Antibody | anti-MREG antibody

MREG (Melanoregulin, DSU, Dilute Suppressor Protein Homolog, FLJ10116, MGC90296, HDCGA21P)

Gene Names
MREG; DSU; WDT2
Reactivity
Human
Applications
ELISA, Western Blot, Immunoprecipitation
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
MREG; Monoclonal Antibody; MREG (Melanoregulin; DSU; Dilute Suppressor Protein Homolog; FLJ10116; MGC90296; HDCGA21P); Anti -MREG (Melanoregulin; anti-MREG antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
8F9-1B2
Specificity
Recognizes human DSU.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MGLRDWLRTVCCCCGCECLEERALPEKEPLVSDNNPYSSFGATLVRDDEKNLWSMPHDVSHTEADDDRTLYNLIVIRNQQAKDSEEWQKLNYDIHTLRQVRREVRNRWKCILEDLGFQKEADSLLSVTKLSTISDSKNTRKAREMLLKLAEETNIFPTSWELSERYLFVVDRLIALDAAEEFFKLARRTYPKKPGVPCLADGQKELHYLPFPSP
Applicable Applications for anti-MREG antibody
ELISA (EL/EIA), Western Blot (WB), Immunoprecipitation (IP)
Application Notes
Suitable for use in ELISA, Western Blot and Immunoprecipitation.
Immunogen
Full length recombinant corresponding to aa1-215 from human DSU (AAH32747) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (49.65kD).)

Western Blot (WB) (Western Blot detection against Immunogen (49.65kD).)

Western Blot (WB)

(DSU monoclonal antibody, Western Blot analysis of DSU expression in MCF-7.)

Western Blot (WB) (DSU monoclonal antibody, Western Blot analysis of DSU expression in MCF-7.)

Western Blot (WB)

(Western Blot analysis of DSU expression in transfected 293T cell line by DSU monoclonal antibody.|Lane 1: DSU transfected lysate (25kD).|Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of DSU expression in transfected 293T cell line by DSU monoclonal antibody.|Lane 1: DSU transfected lysate (25kD).|Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of MREG transfected lysate using MREG monoclonal antibody and Protein A Magnetic Bead and immunoblotted with MREG rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of MREG transfected lysate using MREG monoclonal antibody and Protein A Magnetic Bead and immunoblotted with MREG rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged DSU is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged DSU is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-MREG antibody
Plays a role in the incorporation of pigments into hair. May function in membrane fusion and regulate the biogenesis of disk membranes of photoreceptor rod cells.
Product Categories/Family for anti-MREG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
24,927 Da
NCBI Official Full Name
MREG protein
NCBI Official Synonym Full Names
melanoregulin
NCBI Official Symbol
MREG
NCBI Official Synonym Symbols
DSU; WDT2
NCBI Protein Information
melanoregulin; whn-dependent transcript 2; dilute suppressor protein homolog
UniProt Protein Name
Melanoregulin
Protein Family
UniProt Gene Name
MREG
UniProt Synonym Gene Names
DSU
UniProt Entry Name
MREG_HUMAN

Uniprot Description

MREG: Plays a role in the incorporation of pigments into hair. May function in membrane fusion and regulate the biogenesis of disk membranes of photoreceptor rod cells. Belongs to the melanoregulin family. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 2q35

Cellular Component: protein complex; apical plasma membrane; melanosome

Biological Process: melanocyte differentiation; melanosome transport

Research Articles on MREG

Similar Products

Product Notes

The MREG mreg (Catalog #AAA6006908) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MREG (Melanoregulin, DSU, Dilute Suppressor Protein Homolog, FLJ10116, MGC90296, HDCGA21P) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MREG can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunoprecipitation (IP). Suitable for use in ELISA, Western Blot and Immunoprecipitation. Researchers should empirically determine the suitability of the MREG mreg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGLRDWLRTV CCCCGCECLE ERALPEKEPL VSDNNPYSSF GATLVRDDEK NLWSMPHDVS HTEADDDRTL YNLIVIRNQQ AKDSEEWQKL NYDIHTLRQV RREVRNRWKC ILEDLGFQKE ADSLLSVTKL STISDSKNTR KAREMLLKLA EETNIFPTSW ELSERYLFVV DRLIALDAAE EFFKLARRTY PKKPGVPCLA DGQKELHYLP FPSP. It is sometimes possible for the material contained within the vial of "MREG, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.