Mouse anti-Human MPZL2 Monoclonal Antibody | anti-MPZL2 antibody

MPZL2 (Myelin Protein Zero-like Protein 2, Epithelial V-like Antigen 1, EVA, EVA1, UNQ606/PRO1192) (HRP)

Cat. Num. AAA6153581

• Gene Names: MPZL2; EVA; EVA1; DFNB111
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MPZL2; Monoclonal Antibody; MPZL2 (Myelin Protein Zero-like Protein 2; Epithelial V-like Antigen 1; EVA; EVA1; UNQ606/PRO1192) (HRP); anti-MPZL2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2E10
• Specificity: Recognizes human MPZL2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-MPZL2 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa27-136 from human MPZL2 with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VEIYTSRVLEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDGGPEQFVFYYHIDPFQPMSGRFKDRVSWDGNPERYDASILLWKLQFDDNGTYTCQVKNPPDVDGVIG
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for MBS648840 is 1ng/ml as a capture antibody.)

Related Product Information for anti-MPZL2 antibody

Epithelial V-like antigen (EVA) is expressed in thymus epithelium and strongly downregulated by thymocyte developmental progression. EVA1 is expressed in the thymus and in several epithelial structures early in embryogenesis. It is highly homologous to the myelin protein zero and is poorly soluble in nonionic detergents, strongly suggesting an association to the cytoskeleton. Its capacity to mediate cell adhesion through a homophilic interaction and its selective regulation by T cell maturation might imply the participation of EVA in the earliest phases of thymus organogenesis. The protein bears a characteristic V-type domain and two potential N-glycosylation sites in the extracellular domain; a putative serine phosphorylation site for casein kinase 2 is also present in the cytoplasmic tail. EVA1 expression is elevated in some T-cell leukemias. There are two isoforms.

Product Categories/Family for anti-MPZL2 antibody

Antibodies; Membrane Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 5032247
• NCBI GeneID: 10205
• NCBI Accession #: NP_005788
• NCBI GenBank Nucleotide #: NM_005797
• UniProt Accession #: O70255; O60487
• Molecular Weight: 22kDa
• NCBI Official Full Name: myelin protein zero-like protein 2
• NCBI Official Synonym Full Names: myelin protein zero like 2
• NCBI Official Symbol: MPZL2
• NCBI Official Synonym Symbols: EVA; EVA1; DFNB111
• NCBI Protein Information: myelin protein zero-like protein 2
• UniProt Protein Name: Myelin protein zero-like protein 2
• Protein Family: Myelin protein zero-like protein
• UniProt Gene Name: Mpzl2
• UniProt Synonym Gene Names: Eva; Eva1
• UniProt Entry Name: MPZL2_MOUSE

NCBI Description

Thymus development depends on a complex series of interactions between thymocytes and the stromal component of the organ. Epithelial V-like antigen (EVA) is expressed in thymus epithelium and strongly downregulated by thymocyte developmental progression. This gene is expressed in the thymus and in several epithelial structures early in embryogenesis. It is highly homologous to the myelin protein zero and, in thymus-derived epithelial cell lines, is poorly soluble in nonionic detergents, strongly suggesting an association to the cytoskeleton. Its capacity to mediate cell adhesion through a homophilic interaction and its selective regulation by T cell maturation might imply the participation of EVA in the earliest phases of thymus organogenesis. The protein bears a characteristic V-type domain and two potential N-glycosylation sites in the extracellular domain; a putative serine phosphorylation site for casein kinase 2 is also present in the cytoplasmic tail. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]