Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human MOB1B Monoclonal Antibody | anti-MOB1B antibody

MOB1B (MOB Kinase Activator 1B, Mob1 Homolog 1A, Mob1A, Mob1B, Mps One Binder Kinase Activator-like 1A, MOB4A, MOBKL1A, MGC33910)

Gene Names
MOB1B; MATS2; MOB4A; MOBKL1A
Reactivity
Human
Applications
ELISA
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
MOB1B; Monoclonal Antibody; MOB1B (MOB Kinase Activator 1B; Mob1 Homolog 1A; Mob1A; Mob1B; Mps One Binder Kinase Activator-like 1A; MOB4A; MOBKL1A; MGC33910); Anti -MOB1B (MOB Kinase Activator 1B; anti-MOB1B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2F8
Specificity
Recognizes human MOBKL1A.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
TWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLTSKDR
Applicable Applications for anti-MOB1B antibody
ELISA (EL/EIA)
Application Notes
Suitable for use in ELISA.
Immunogen
Partial recombinant corresponding to aa120-217 from human MOBKL1A (NP_775739) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Related Product Information for anti-MOB1B antibody
Activator of LATS1/2 in the Hippo signaling pathway which plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. Stimulates the kinase activity of STK38L.
Product Categories/Family for anti-MOB1B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,091 Da
NCBI Official Full Name
MOB kinase activator 1B isoform 3
NCBI Official Synonym Full Names
MOB kinase activator 1B
NCBI Official Symbol
MOB1B
NCBI Official Synonym Symbols
MATS2; MOB4A; MOBKL1A
NCBI Protein Information
MOB kinase activator 1B; mob1A; mob1 homolog 1A; MOB1 Mps One Binder homolog B; mps one binder kinase activator-like 1A; MOB1, Mps One Binder kinase activator-like 1A
UniProt Protein Name
MOB kinase activator 1B
Protein Family
UniProt Gene Name
MOB1B
UniProt Synonym Gene Names
MOB4A; MOBKL1A; Mob1A
UniProt Entry Name
MOB1B_HUMAN

NCBI Description

The protein encoded by this gene is similar to the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]

Uniprot Description

MOB1B: Activator of LATS1/2 in the Hippo signaling pathway which plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. Stimulates the kinase activity of STK38L. Binds STK38L. Interacts with LATS1 and LATS2. Adrenal gland, bone marrow, brain, lung, placenta, prostate, salivary gland, skeletal muscle, testis, thymus, thyroid gland, uterus, colon with mucosa, fetal brain and fetal liver. Belongs to the MOB1/phocein family.

Protein type: Protein kinase, regulatory subunit; Activator

Chromosomal Location of Human Ortholog: 4q13.3

Cellular Component: cytoplasm; nucleus; cytosol

Molecular Function: protein binding; metal ion binding; kinase activator activity; kinase binding

Biological Process: protein amino acid autophosphorylation; positive regulation of phosphorylation

Research Articles on MOB1B

Similar Products

Product Notes

The MOB1B mob1b (Catalog #AAA644459) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MOB1B (MOB Kinase Activator 1B, Mob1 Homolog 1A, Mob1A, Mob1B, Mps One Binder Kinase Activator-like 1A, MOB4A, MOBKL1A, MGC33910) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MOB1B can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA). Suitable for use in ELISA. Researchers should empirically determine the suitability of the MOB1B mob1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TWVQDQLDDE TLFPSKIGVP FPKNFMSVAK TILKRLFRVY AHIYHQHFDP VIQLQEEAHL NTSFKHFIFF VQEFNLIDRR ELAPLQELIE KLTSKDR. It is sometimes possible for the material contained within the vial of "MOB1B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.