Mouse anti-Human MNDA Monoclonal Antibody | anti-MNDA antibody

MNDA (Myeloid Cell Nuclear Differentiation antigen, PYHIN3) (PE)

Cat. Num. AAA6186703

• Gene Names: MNDA; PYHIN3
• Reactivity: Human
• Applications: Immunofluorescence, Immunohistochemistry
• Purity: Purified
• Synonyms: MNDA; Monoclonal Antibody; MNDA (Myeloid Cell Nuclear Differentiation antigen; PYHIN3) (PE); Myeloid Cell Nuclear Differentiation antigen; PYHIN3; anti-MNDA antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1H2
• Specificity: Recognizes MNDA. Species Crossreactivity: human
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-MNDA antibody: Immunofluorescence (IF), Immunohistochemistry (IHC)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: MNDA (NP_002423.1, 311aa-407aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: QLYKQASGTMVYGLFMLQKKSVHKKNTIYEIQDNTGSMDVVGSGKWHNIKCEKGDKLRLFCLQLRTVDRKLKLVCGSHSFIKVIKAKKNKEGPMNVN
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to MNDA on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to MNDA on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml])

Testing Data

(Detection limit for recombinant GST tagged MNDA is 3 ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MNDA on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MNDA on HeLa cell. [antibody concentration 10 ug/ml])

Related Product Information for anti-MNDA antibody

The myeloid cell nuclear differentiation antigen (MNDA) is detected only in nuclei of cells of the granulocyte-monocyte lineage. A 200-amino acid region of human MNDA is strikingly similar to a region in the proteins encoded by a family of interferon-inducible mouse genes, designated Ifi-201, Ifi-202, and Ifi-203, that are not regulated in a cell- or tissue-specific fashion. The 1.8-kb MNDA mRNA, which contains an interferon-stimulated response element in the 5-prime untranslated region, was significantly upregulated in human monocytes exposed to interferon alpha. MNDA is located within 2,200 kb of FCER1A, APCS, CRP, and SPTA1. In its pattern of expression and/or regulation, MNDA resembles IFI16, suggesting that these genes participate in blood cell-specific responses to interferons. [provided by RefSeq]

Product Categories/Family for anti-MNDA antibody

Antibodies; Nuclear Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 4505227
• NCBI GeneID: 4332
• NCBI Accession #: NP_002423.1
• NCBI GenBank Nucleotide #: NM_002432.1
• UniProt Accession #: P41218
• Molecular Weight: 45,836 Da
• NCBI Official Full Name: myeloid cell nuclear differentiation antigen
• NCBI Official Synonym Full Names: myeloid cell nuclear differentiation antigen
• NCBI Official Symbol: MNDA
• NCBI Official Synonym Symbols: PYHIN3
• NCBI Protein Information: myeloid cell nuclear differentiation antigen
• UniProt Protein Name: Myeloid cell nuclear differentiation antigen
• Protein Family: Myeloid cell nuclear differentiation antigen
• UniProt Gene Name: MNDA
• UniProt Entry Name: MNDA_HUMAN

NCBI Description

The myeloid cell nuclear differentiation antigen (MNDA) is detected only in nuclei of cells of the granulocyte-monocyte lineage. A 200-amino acid region of human MNDA is strikingly similar to a region in the proteins encoded by a family of interferon-inducible mouse genes, designated Ifi-201, Ifi-202, and Ifi-203, that are not regulated in a cell- or tissue-specific fashion. The 1.8-kb MNDA mRNA, which contains an interferon-stimulated response element in the 5-prime untranslated region, was significantly upregulated in human monocytes exposed to interferon alpha. MNDA is located within 2,200 kb of FCER1A, APCS, CRP, and SPTA1. In its pattern of expression and/or regulation, MNDA resembles IFI16, suggesting that these genes participate in blood cell-specific responses to interferons. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: May act as a transcriptional activator/repressor in the myeloid lineage. Plays a role in the granulocyte/monocyte cell-specific response to interferon. Stimulates the DNA binding of the transcriptional repressor protein YY1.

Subunit structure: Participates in a ternary complex with YY1 and the YY1 target DNA element. Binds nucleolin and nucleophosmin/NPM/B23.

Subcellular location: Nucleus. Cytoplasm. Note: Uniformly distributed throughout the interphase cell nucleus. Associates with chromatin.

Tissue specificity: Expressed constitutively in cells of the myeloid lineage. Found in promyelocyte stage cells as well as in all other stage cells including peripheral blood monocytes and granulocytes. Also appear in myeloblast cells in some cases of acute myeloid Leukemia. Ref.5

Induction: Strongly induced by alpha interferon which selectively affects expression in late stage cells in the monocytic but not the granulocytic lineage. Induced in vitro by dimethylsulfoxide and 1,25 dihydroxyvitamin D3. Ref.4 Ref.5 Ref.6

Domain: Its N-terminal half (200 amino acids) is sufficient for maximum enhancement of YY1 DNA binding and a portion of this sequence is responsible for binding YY1.

Sequence similarities: Contains 1 DAPIN domain.Contains 1 HIN-200 domain.