Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human ERBB2IP Monoclonal Antibody | anti-ERBB2IP antibody

ERBB2IP (ERBIN, Protein LAP2, Densin-180-like Protein, Erbb2-interacting Protein, KIAA1225, LAP2) (HRP)

Gene Names
ERBIN; LAP2; ERBB2IP; HEL-S-78
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography
Synonyms
ERBB2IP; Monoclonal Antibody; ERBB2IP (ERBIN; Protein LAP2; Densin-180-like Protein; Erbb2-interacting Protein; KIAA1225; LAP2) (HRP); anti-ERBB2IP antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
10G1
Specificity
Recognizes human ERBB2IP.
Purity/Purification
Purified by Protein A Affinity Chromatography
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
1371
Applicable Applications for anti-ERBB2IP antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1272-1372 from human ERBB2IP (NP_061165) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QGHELAKQEIRVRVEKDPELGFSISGGVGGRGNPFRPDDDGIFVTRVQPEGPASKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQNTVELIIVREVSS
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Testing Data

(Detection limit for recombinant GST tagged ERBB2IP is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ERBB2IP is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-ERBB2IP antibody
Acts as an adapter for the receptor ERBB2, in epithelia. By binding the unphosphorylated 'Tyr-1248' of receptor ERBB2, it may contribute to stabilize this unphosphorylated state.
Product Categories/Family for anti-ERBB2IP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
erbin isoform 2
NCBI Official Synonym Full Names
erbb2 interacting protein
NCBI Official Symbol
ERBIN
NCBI Official Synonym Symbols
LAP2; ERBB2IP; HEL-S-78
NCBI Protein Information
erbin
UniProt Protein Name
Protein LAP2
UniProt Gene Name
ERBB2IP
UniProt Synonym Gene Names
ERBIN; KIAA1225; LAP2; Erbin
UniProt Entry Name
LAP2_HUMAN

NCBI Description

This gene is a member of the leucine-rich repeat and PDZ domain (LAP) family. The encoded protein contains 17 leucine-rich repeats and one PDZ domain. It binds to the unphosphorylated form of the ERBB2 protein and regulates ERBB2 function and localization. It has also been shown to affect the Ras signaling pathway by disrupting Ras-Raf interaction. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Nov 2011]

Uniprot Description

Erbin: Acts as an adapter for the receptor ERBB2, in epithelia. By binding the unphosphorylated 'Tyr-1248' of receptor ERBB2, it may contribute to stabilize this unphosphorylated state. Belongs to the LAP (LRR and PDZ) protein family. 7 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell adhesion

Chromosomal Location of Human Ortholog: 5q12.3

Cellular Component: nucleoplasm; nuclear membrane; hemidesmosome; cytoplasm; basal plasma membrane; plasma membrane; basement membrane; cell junction; nucleus

Molecular Function: integrin binding; ErbB-2 class receptor binding; protein binding; structural constituent of cytoskeleton

Biological Process: integrin-mediated signaling pathway; establishment and/or maintenance of epithelial cell polarity; epidermal growth factor receptor signaling pathway; basal protein localization; intermediate filament cytoskeleton organization and biogenesis; cell adhesion; cell growth; signal transduction; cell cycle; protein targeting

Research Articles on ERBB2IP

Similar Products

Product Notes

The ERBB2IP erbb2ip (Catalog #AAA6152371) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ERBB2IP (ERBIN, Protein LAP2, Densin-180-like Protein, Erbb2-interacting Protein, KIAA1225, LAP2) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ERBB2IP can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ERBB2IP erbb2ip for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ERBB2IP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.