Mouse anti-Human MMP3 Monoclonal Antibody | anti-MMP3 antibody

MMP3 (Stromelysin-1, SL-1, Matrix Metalloproteinase-3, MMP-3, Transin-1, STMY1, MGC126102, MGC126103, MGC126104) (Biotin)

Cat. Num. AAA6142952

• Gene Names: MMP3; SL-1; STMY; STR1; CHDS6; MMP-3; STMY1
• Reactivity: Human
• Applications: ELISA, Immunoprecipitation
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MMP3; Monoclonal Antibody; MMP3 (Stromelysin-1; SL-1; Matrix Metalloproteinase-3; MMP-3; Transin-1; STMY1; MGC126102; MGC126103; MGC126104) (Biotin); anti-MMP3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 4C11
• Specificity: Recognizes human MMP3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-MMP3 antibody: ELISA (EIA), Immunoprecipitation (IP)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa22-131 from human MMP3 (NP_002413) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GAARGEDTSMNLVQKYLENYYDLKKDVKQFVRRKDSGPVVKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDVGHFRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVD
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of MMP3 transfected lysate using anti-MMP3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with MMP3 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged MMP3 is ~3ng/ml as a capture antibody.)

Related Product Information for anti-MMP3 antibody

Proteins of the matrix metalloprotease family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling as well as disease processes such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases.

Product Categories/Family for anti-MMP3 antibody

Antibodies; Matrix Metalloproteinases

NCBI and Uniprot Product Information

• NCBI GI #: 4505217
• NCBI GeneID: 4314
• NCBI Accession #: NP_002413
• NCBI GenBank Nucleotide #: NM_002422
• UniProt Accession #: P08254; Q3B7S0; Q6GRF8; B2R8B8
• Molecular Weight: 45.2 kDa (401aa) confirmed by MALDI-TOF
• NCBI Official Full Name: stromelysin-1 preproprotein
• NCBI Official Synonym Full Names: matrix metallopeptidase 3
• NCBI Official Symbol: MMP3
• NCBI Official Synonym Symbols: SL-1; STMY; STR1; CHDS6; MMP-3; STMY1
• NCBI Protein Information: stromelysin-1
• UniProt Protein Name: Stromelysin-1
• Protein Family: Stromelysin
• UniProt Gene Name: MMP3
• UniProt Synonym Gene Names: STMY1; SL-1; MMP-3
• UniProt Entry Name: MMP3_HUMAN

NCBI Description

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This gene encodes an enzyme which degrades fibronectin, laminin, collagens III, IV, IX, and X, and cartilage proteoglycans. The enzyme is thought to be involved in wound repair, progression of atherosclerosis, and tumor initiation. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Can degrade fibronectin, laminin, gelatins of type I, III, IV, and V; collagens III, IV, X, and IX, and cartilage proteoglycans. Activates procollagenase.

Catalytic activity: Preferential cleavage where P1', P2' and P3' are hydrophobic residues.

Cofactor: Binds 4 calcium ions per subunit.Binds 2 zinc ions per subunit.

Subcellular location: Secreted › extracellular space › extracellular matrix

Probable.

Domain: The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme. Ref.13

Involvement in disease: Coronary heart disease 6 (CHDS6) [MIM:614466]: A multifactorial disease characterized by an imbalance between myocardial functional requirements and the capacity of the coronary vessels to supply sufficient blood flow. Decreased capacity of the coronary vessels is often associated with thickening and loss of elasticity of the coronary arteries.Note: Disease susceptibility is associated with variations affecting the gene represented in this entry. A polymorphism in the MMP3 promoter region is associated with the risk of coronary heart disease and myocardial infarction, due to lower MMP3 proteolytic activity and higher extracellular matrix deposition in atherosclerotic lesions. Ref.11 Ref.12

Sequence similarities: Belongs to the peptidase M10A family.Contains 4 hemopexin-like domains.