Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.47kD).)

Mouse anti-Human MKRN1 Monoclonal Antibody | anti-MKRN1 antibody

MKRN1 (E3 Ubiquitin-protein Ligase Makorin-1, RING Finger Protein 61, RNF61) (PE)

Gene Names
MKRN1; RNF61
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MKRN1; Monoclonal Antibody; MKRN1 (E3 Ubiquitin-protein Ligase Makorin-1; RING Finger Protein 61; RNF61) (PE); anti-MKRN1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4E9
Specificity
Recognizes human MKRN1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-MKRN1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa365-441 from MKRN1 (NP_038474) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSNKACRYFDEGRGSCPFGGNCFYKHAYPDGRREEPQRQKVGTSSRYRAQRRNHFWELIEERENSNPFDNDEEEVV*
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.47kD).)

Western Blot (WB) (Western Blot detection against Immunogen (34.47kD).)

Testing Data

(Detection limit for recombinant GST tagged MKRN1 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MKRN1 is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-MKRN1 antibody
MKRN1 (Makorin ring finger protein 1) is a a ubiquitously expressed novel RING zinc finger protein, a member of the Makorin family of proteins. The MKRN gene family encodes putative ribonucleoproteins with a distinctive array of zinc finger motifs, including two to four C(3)H zinc fingers, an unusual Cys/His arrangement that may represent a novel zinc finger structure, and a highly conserved RING zinc finger. So far, nine MKRN family loci have been found distributed throughout the human genome. The MKRN1 gene is highly transcribed in mammals. The MKRN1 protein has been shown to act as an E3 ubiquitin ligase and may represent a nuclear protein with multiple nuclear functions, including the regulation of RNA polymerase II catalyzed transcription.
Product Categories/Family for anti-MKRN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,224 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase makorin-1 isoform 1
NCBI Official Synonym Full Names
makorin ring finger protein 1
NCBI Official Symbol
MKRN1
NCBI Official Synonym Symbols
RNF61
NCBI Protein Information
E3 ubiquitin-protein ligase makorin-1; RING finger protein 61
UniProt Protein Name
E3 ubiquitin-protein ligase makorin-1
UniProt Gene Name
MKRN1
UniProt Synonym Gene Names
RNF61
UniProt Entry Name
MKRN1_HUMAN

Similar Products

Product Notes

The MKRN1 mkrn1 (Catalog #AAA6158844) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MKRN1 (E3 Ubiquitin-protein Ligase Makorin-1, RING Finger Protein 61, RNF61) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MKRN1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MKRN1 mkrn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MKRN1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.