Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (MGAT4B monoclonal antibody Western Blot analysis of MGAT4B expression in human pancreas.)

Mouse anti-Human MGAT4B Monoclonal Antibody | anti-MGAT4B antibody

MGAT4B (Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B, N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVb, GlcNAc-T IVb, GnT-IVb, N-acetylglucosaminyltransferase IVb, UDP-N-acetylglucosamine: alpha-1,3-D

Gene Names
MGAT4B; GNT-IV; GNT-IVB
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MGAT4B; Monoclonal Antibody; MGAT4B (Alpha-1; 3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B; N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVb; GlcNAc-T IVb; GnT-IVb; N-acetylglucosaminyltransferase IVb; UDP-N-acetylglucosamine: alpha-1; 3-D; anti-MGAT4B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1F4
Specificity
Recognizes human MGAT4B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
548
Applicable Applications for anti-MGAT4B antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa401-501 from MGAT4B (NP_055090) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AEVSTSLKTYQHFTLEKAYLREDFFWAFTPAAGDFIRFRFFQPLRLERFFFRSGNIEHPEDKLFNTSVEVLPFDNPQSDKEALQEGRTATLRYPRSPDGY*
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(MGAT4B monoclonal antibody Western Blot analysis of MGAT4B expression in human pancreas.)

Western Blot (WB) (MGAT4B monoclonal antibody Western Blot analysis of MGAT4B expression in human pancreas.)
Related Product Information for anti-MGAT4B antibody
Glycosyltransferase that participates in the transfer of N-acetylglucosamine (GlcNAc) to the core mannose residues of N-linked glycans. Catalyzes the formation of the GlcNAcbeta1-4 branch on the GlcNAcbeta1-2Manalpha1-3 arm of the core structure of N-linked glycans. Essential for the production of tri- and tetra-antennary N-linked sugar chains. Has lower affinities for donors or acceptors than MGAT4A, suggesting that, under physiological conditions, it is not the main contributor in N-glycan biosynthesis.
Product Categories/Family for anti-MGAT4B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B isoform 1
NCBI Official Synonym Full Names
alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B
NCBI Official Symbol
MGAT4B
NCBI Official Synonym Symbols
GNT-IV; GNT-IVB
NCBI Protein Information
alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B
UniProt Protein Name
Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B
UniProt Gene Name
MGAT4B
UniProt Synonym Gene Names
UNQ906/PRO1927; GlcNAc-T IVb; GnT-IVb; N-acetylglucosaminyltransferase IVb
UniProt Entry Name
MGT4B_HUMAN

NCBI Description

This gene encodes a key glycosyltransferase that regulates the formation of tri- and multiantennary branching structures in the Golgi apparatus. The encoded protein, in addition to the related isoenzyme A, catalyzes the transfer of N-acetylglucosamine (GlcNAc) from UDP-GlcNAc in a beta-1,4 linkage to the Man-alpha-1,3-Man-beta-1,4-GlcNAc arm of R-Man-alpha-1,6(GlcNAc-beta-1,2-Man-alpha-1,3)Man-beta-1,4-GlcNAc-beta-1,4-GlcNAc-beta-1-Asn. The encoded protein may play a role in regulating the availability of serum glycoproteins, oncogenesis, and differentiation. [provided by RefSeq, Jul 2008]

Research Articles on MGAT4B

Similar Products

Product Notes

The MGAT4B mgat4b (Catalog #AAA6142907) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MGAT4B (Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B, N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVb, GlcNAc-T IVb, GnT-IVb, N-acetylglucosaminyltransferase IVb, UDP-N-acetylglucosamine: alpha-1,3-D reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MGAT4B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MGAT4B mgat4b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MGAT4B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.