<
Western Blot (WB)
(Western Blot detection against Immunogen (37.11kD).)
Mouse anti-Human MGAT4A Monoclonal Antibody | anti-MGAT4A antibody
MGAT4A (Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A, GlcNAc-T IVa, GNT-IV, GnT-Iva, GnT-IVa, GNT-IVA, N-acetylglucosaminyltransferase IVa, N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVa, Mannosyl (
Gene Names
MGAT4A; GNT-IV; GnT-4a; GNT-IVA
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MGAT4A; Monoclonal Antibody; MGAT4A (Alpha-1; 3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A; GlcNAc-T IVa; GNT-IV; GnT-Iva; GnT-IVa; GNT-IVA; N-acetylglucosaminyltransferase IVa; N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVa; Mannosyl (; anti-MGAT4A antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4H4
Specificity
Recognizes human MGAT4A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
535
Applicable Applications for anti-MGAT4A antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 0.2ug/ml
Applications are based on unconjugated antibody.
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa436-536 from MGAT4A (NP_036346) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PVNVESYLFHSGNQEHPGDILLNTTVEVLPFKSEGLEISKETKDKRLEDGYFRIGKFENGVAEGMVDPSLNPISAFRLSVIQNSAVWAILNEIHIKKATN*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (37.11kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (37.11kD).)
Western Blot (WB)
(MGAT4A monoclonal antibody Western Blot analysis of MGAT4A expression in Jurkat.)
Western Blot (WB)
(MGAT4A monoclonal antibody Western Blot analysis of MGAT4A expression in Jurkat.)
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to MGAT4A on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 0.2ug/ml])
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to MGAT4A on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 0.2ug/ml])
Testing Data
(Detection limit for recombinant GST tagged MGAT4A is ~0.1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged MGAT4A is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-MGAT4A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A isoform 1
NCBI Official Synonym Full Names
alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A
NCBI Official Symbol
MGAT4A
NCBI Official Synonym Symbols
GNT-IV; GnT-4a; GNT-IVA
NCBI Protein Information
alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A
UniProt Protein Name
Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A
UniProt Gene Name
MGAT4A
UniProt Synonym Gene Names
GlcNAc-T IVa; GnT-IVa; N-acetylglucosaminyltransferase IVa
UniProt Entry Name
MGT4A_HUMAN
NCBI Description
This gene encodes a key glycosyltransferase that regulates the formation of tri- and multiantennary branching structures in the Golgi apparatus. The encoded protein, in addition to the related isoenzyme B, catalyzes the transfer of N-acetylglucosamine (GlcNAc) from UDP-GlcNAc in a beta-1,4 linkage to the Man-alpha-1,3-Man-beta-1,4-GlcNAc arm of R-Man-alpha-1,6(GlcNAc-beta-1,2-Man-alpha-1,3)Man-beta-1,4-GlcNAc-beta-1,4-GlcNAc-beta-1-Asn. The encoded protein may play a role in regulating the availability of serum glycoproteins, oncogenesis, and differentiation. [provided by RefSeq, Jul 2008]
Research Articles on MGAT4A
Similar Products
Product Notes
The MGAT4A mgat4a (Catalog #AAA6132300) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MGAT4A (Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A, GlcNAc-T IVa, GNT-IV, GnT-Iva, GnT-IVa, GNT-IVA, N-acetylglucosaminyltransferase IVa, N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVa, Mannosyl ( reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MGAT4A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 0.2ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MGAT4A mgat4a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MGAT4A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
