Mouse anti-Human MGAT3 Monoclonal Antibody | anti-MGAT3 antibody

MGAT3 (Beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase, GGNT3, N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase III, N-acetylglucosaminyltransferase III, GlcNAc-T III, GNT-III, FLJ43371, MGC141943, MGC142278) (

Cat. Num. AAA6158814

• Gene Names: MGAT3; GNT3; GNT-III
• Reactivity: Human
• Applications: ELISA, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MGAT3; Monoclonal Antibody; MGAT3 (Beta-1; 4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase; GGNT3; N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase III; N-acetylglucosaminyltransferase III; GlcNAc-T III; GNT-III; FLJ43371; MGC141943; MGC142278) (; anti-MGAT3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2G4
• Specificity: Recognizes human MGAT3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-MGAT3 antibody: ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa430-532 from human MGAT3 (NP_002400) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LVSAQNGDFPRWGDYEDKRDLNYIRGLIRTGGWFDGTQQEYPPADPSEHMYAPKYLLKNYDRFHYLLDNPYQEPRSTAAGGWRHRGPEGRPPARGKLDEAEV
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.96kD).)

Western Blot (WB)

(Western Blot analysis of MGAT3 expression in transfected 293T cell line by MGAT3 monoclonal antibody. Lane 1: MGAT3 transfected lysate (Predicted MW: 61.3kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of MGAT3 transfected lysate using anti-MGAT3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with MGAT3 rabbit polyclonal antibody.)

Related Product Information for anti-MGAT3 antibody

There are believed to be over 100 different glycosyltransferases involved in the synthesis of protein-bound and lipid-bound oligosaccharides. MGAT3 (N-acetylglucosaminyltransferase III) transfers a GlcNAc residue to the beta-linked mannose of the trimannosyl core of N-linked oligosaccharides and produces a bisecting GlcNAc. Expression of this gene may be controlled by a multiple-promoter system.

Product Categories/Family for anti-MGAT3 antibody

Antibodies; Carbohydrates; Glycoproteins

NCBI and Uniprot Product Information

• NCBI GI #: 148539888
• NCBI GeneID: 4248
• NCBI Accession #: NP_002400
• NCBI GenBank Nucleotide #: NM_002409
• UniProt Accession #: Q09327; Q14CK5; Q6IC49; Q9UH32; A6NGD0
• Molecular Weight: 61,313 Da
• NCBI Official Full Name: beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase
• NCBI Official Synonym Full Names: mannosyl (beta-1,4-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase
• NCBI Official Symbol: MGAT3
• NCBI Official Synonym Symbols: GNT3; GNT-III
• NCBI Protein Information: beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase
• UniProt Protein Name: Beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase
• Protein Family: Beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase
• UniProt Gene Name: MGAT3
• UniProt Synonym Gene Names: GGNT3; GNT-III; GlcNAc-T III; N-acetylglucosaminyltransferase III
• UniProt Entry Name: MGAT3_HUMAN

NCBI Description

There are believed to be over 100 different glycosyltransferases involved in the synthesis of protein-bound and lipid-bound oligosaccharides. The enzyme encoded by this gene transfers a GlcNAc residue to the beta-linked mannose of the trimannosyl core of N-linked oligosaccharides and produces a bisecting GlcNAc. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]