Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.96kD).)

Mouse anti-Human MGAT3 Monoclonal Antibody | anti-MGAT3 antibody

MGAT3 (Beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase, GGNT3, N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase III, N-acetylglucosaminyltransferase III, GlcNAc-T III, GNT-III, FLJ43371, MGC141943, MGC142278) A

Gene Names
MGAT3; GNT3; GNT-III
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MGAT3; Monoclonal Antibody; MGAT3 (Beta-1; 4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase; GGNT3; N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase III; N-acetylglucosaminyltransferase III; GlcNAc-T III; GNT-III; FLJ43371; MGC141943; MGC142278) A; anti-MGAT3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2G4
Specificity
Recognizes human MGAT3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-MGAT3 antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa430-532 from human MGAT3 (NP_002400) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LVSAQNGDFPRWGDYEDKRDLNYIRGLIRTGGWFDGTQQEYPPADPSEHMYAPKYLLKNYDRFHYLLDNPYQEPRSTAAGGWRHRGPEGRPPARGKLDEAEV
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.96kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.96kD).)

Western Blot (WB)

(Western Blot analysis of MGAT3 expression in transfected 293T cell line by MGAT3 monoclonal antibody. Lane 1: MGAT3 transfected lysate (Predicted MW: 61.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MGAT3 expression in transfected 293T cell line by MGAT3 monoclonal antibody. Lane 1: MGAT3 transfected lysate (Predicted MW: 61.3kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of MGAT3 transfected lysate using anti-MGAT3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with MGAT3 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of MGAT3 transfected lysate using anti-MGAT3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with MGAT3 rabbit polyclonal antibody.)
Related Product Information for anti-MGAT3 antibody
There are believed to be over 100 different glycosyltransferases involved in the synthesis of protein-bound and lipid-bound oligosaccharides. MGAT3 (N-acetylglucosaminyltransferase III) transfers a GlcNAc residue to the beta-linked mannose of the trimannosyl core of N-linked oligosaccharides and produces a bisecting GlcNAc. Expression of this gene may be controlled by a multiple-promoter system.
Product Categories/Family for anti-MGAT3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61,313 Da
NCBI Official Full Name
beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase
NCBI Official Synonym Full Names
mannosyl (beta-1,4-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase
NCBI Official Symbol
MGAT3
NCBI Official Synonym Symbols
GNT3; GNT-III
NCBI Protein Information
beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase
UniProt Protein Name
Beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase
UniProt Gene Name
MGAT3
UniProt Synonym Gene Names
GGNT3; GNT-III; GlcNAc-T III; N-acetylglucosaminyltransferase III
UniProt Entry Name
MGAT3_HUMAN

NCBI Description

There are believed to be over 100 different glycosyltransferases involved in the synthesis of protein-bound and lipid-bound oligosaccharides. The enzyme encoded by this gene transfers a GlcNAc residue to the beta-linked mannose of the trimannosyl core of N-linked oligosaccharides and produces a bisecting GlcNAc. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]

Research Articles on MGAT3

Similar Products

Product Notes

The MGAT3 mgat3 (Catalog #AAA6137602) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MGAT3 (Beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase, GGNT3, N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase III, N-acetylglucosaminyltransferase III, GlcNAc-T III, GNT-III, FLJ43371, MGC141943, MGC142278) A reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MGAT3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MGAT3 mgat3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MGAT3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.