Mouse anti-Human, Rat MFN2 Monoclonal Antibody | anti-MFN2 antibody

MFN2 (Mitofusin 2, Mitofusin-2, CMT2A, CMT2A2, CPRP1, HSG, KIAA0214, MARF, Transmembrane GTPase MFN2) (HRP)

Cat. Num. AAA6153508

• Gene Names: MFN2; HSG; MARF; CMT2A; CPRP1; CMT2A2; HMSN6A; CMT2A2A; CMT2A2B
• Reactivity: Human, Rat
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MFN2; Monoclonal Antibody; MFN2 (Mitofusin 2; Mitofusin-2; CMT2A; CMT2A2; CPRP1; HSG; KIAA0214; MARF; Transmembrane GTPase MFN2) (HRP); anti-MFN2 antibody

• Host: Mouse
• Reactivity: Human, Rat
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4H8
• Specificity: Recognizes human MFN2. Species Crossreactivity: rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 4407

• Applicable Applications for anti-MFN2 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 5ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa661-757 from MFN2 (NP_055689) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: FKRQFVEHASEKLQLVISYTGSNCSHQVQQELSGTFAHLCQQVDVTRENLEQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(MFN2 monoclonal antibody Western Blot analysis of MFN2 expression in PC-12.)

Western Blot (WB)

(Western Blot analysis of MFN2 expression in transfected 293T cell line by MFN2 monoclonal antibody. Lane 1: MFN2 transfected lysate (86.4kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to MFN2 on formalin-fixed paraffin-embedded human heart. [antibody concentration 5ug/ml])

Testing Data

(Detection limit for recombinant GST tagged MFN2 is ~1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of MFN2 over-expressed 293 cell line, cotransfected with MFN2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with MFN2 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Product Categories/Family for anti-MFN2 antibody

Antibodies; GTPase; Rab; Ras; Rho Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 1732746131
• NCBI GeneID: 9927
• NCBI Accession #: NM_014874.4
• NCBI GenBank Nucleotide #: NM_014874
• UniProt Accession #: O95140
• NCBI Official Full Name: Homo sapiens mitofusin 2 (MFN2), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: mitofusin 2
• NCBI Official Symbol: MFN2
• NCBI Official Synonym Symbols: HSG; MARF; CMT2A; CPRP1; CMT2A2; HMSN6A; CMT2A2A; CMT2A2B
• NCBI Protein Information: mitofusin-2
• UniProt Protein Name: Mitofusin-2
• Protein Family: Mitofusin
• UniProt Gene Name: MFN2
• UniProt Synonym Gene Names: CPRP1; KIAA0214
• UniProt Entry Name: MFN2_HUMAN

NCBI Description

This gene encodes a mitochondrial membrane protein that participates in mitochondrial fusion and contributes to the maintenance and operation of the mitochondrial network. This protein is involved in the regulation of vascular smooth muscle cell proliferation, and it may play a role in the pathophysiology of obesity. Mutations in this gene cause Charcot-Marie-Tooth disease type 2A2, and hereditary motor and sensory neuropathy VI, which are both disorders of the peripheral nervous system. Defects in this gene have also been associated with early-onset stroke. Two transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

MFN2: Essential transmembrane GTPase, which mediates mitochondrial fusion. Fusion of mitochondria occurs in many cell types and constitutes an important step in mitochondria morphology, which is balanced between fusion and fission. MFN2 acts independently of the cytoskeleton. It therefore plays a central role in mitochondrial metabolism and may be associated with obesity and/or apoptosis processes. Overexpression induces the formation of mitochondrial networks. Plays an important role in the regulation of vascular smooth muscle cell proliferation. Defects in MFN2 are the cause of Charcot-Marie-Tooth disease type 2A2 (CMT2A2). CMT2A2 is a form of Charcot-Marie-Tooth disease, the most common inherited disorder of the peripheral nervous system. Charcot-Marie-Tooth disease is classified in two main groups on the basis of electrophysiologic properties and histopathology: primary peripheral demyelinating neuropathy or CMT1, and primary peripheral axonal neuropathy or CMT2. Neuropathies of the CMT2 group are characterized by signs of axonal regeneration in the absence of obvious myelin alterations, normal or slightly reduced nerve conduction velocities, and progressive distal muscle weakness and atrophy. Defects in MFN2 are the cause of Charcot-Marie-Tooth disease type 6 (CMT6); also referred to as autosomal dominant hereditary motor and sensory neuropathy VI (HMSN6). CMT6 is an autosomal dominant form of axonal CMT associated with optic atrophy. Belongs to the mitofusin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell cycle regulation; Cytoskeletal; EC 3.6.5.-; Hydrolase; Mitochondrial; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1p36.22

Cellular Component: microtubule cytoskeleton; mitochondrial outer membrane; mitochondrion; integral to membrane; cytosol; intrinsic to mitochondrial outer membrane

Molecular Function: GTPase activity; protein binding; GTP binding; ubiquitin protein ligase binding

Biological Process: mitochondrial fusion; negative regulation of smooth muscle cell proliferation; apoptosis; mitochondrial membrane organization and biogenesis; blastocyst formation; mitochondrion localization; response to unfolded protein; camera-type eye morphogenesis; autophagy; negative regulation of Ras protein signal transduction; cell cycle arrest; blood coagulation; protein targeting to mitochondrion

Disease: Charcot-marie-tooth Disease, Axonal, Type 2a2; Neuropathy, Hereditary Motor And Sensory, Type Vi