Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (MFN2 monoclonal antibody Western Blot analysis of MFN2 expression in PC-12.)

Mouse anti-Human, Rat MFN2 Monoclonal Antibody | anti-MFN2 antibody

MFN2 (Mitofusin 2, Mitofusin-2, CMT2A, CMT2A2, CPRP1, HSG, KIAA0214, MARF, Transmembrane GTPase MFN2) (AP)

Gene Names
MFN2; HSG; MARF; CMT2A; CPRP1; CMT2A2; HMSN6A; CMT2A2A; CMT2A2B
Reactivity
Human, Rat
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MFN2; Monoclonal Antibody; MFN2 (Mitofusin 2; Mitofusin-2; CMT2A; CMT2A2; CPRP1; HSG; KIAA0214; MARF; Transmembrane GTPase MFN2) (AP); anti-MFN2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4H8
Specificity
Recognizes human MFN2. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
4407
Applicable Applications for anti-MFN2 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 5ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa661-757 from MFN2 (NP_055689) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FKRQFVEHASEKLQLVISYTGSNCSHQVQQELSGTFAHLCQQVDVTRENLEQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(MFN2 monoclonal antibody Western Blot analysis of MFN2 expression in PC-12.)

Western Blot (WB) (MFN2 monoclonal antibody Western Blot analysis of MFN2 expression in PC-12.)

Western Blot (WB)

(Western Blot analysis of MFN2 expression in transfected 293T cell line by MFN2 monoclonal antibody. Lane 1: MFN2 transfected lysate (86.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MFN2 expression in transfected 293T cell line by MFN2 monoclonal antibody. Lane 1: MFN2 transfected lysate (86.4kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to MFN2 on formalin-fixed paraffin-embedded human heart. [antibody concentration 5ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to MFN2 on formalin-fixed paraffin-embedded human heart. [antibody concentration 5ug/ml])

Testing Data

(Detection limit for recombinant GST tagged MFN2 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MFN2 is ~1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of MFN2 over-expressed 293 cell line, cotransfected with MFN2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with MFN2 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of MFN2 over-expressed 293 cell line, cotransfected with MFN2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with MFN2 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)
Product Categories/Family for anti-MFN2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens mitofusin 2 (MFN2), transcript variant 1, mRNA
NCBI Official Synonym Full Names
mitofusin 2
NCBI Official Symbol
MFN2
NCBI Official Synonym Symbols
HSG; MARF; CMT2A; CPRP1; CMT2A2; HMSN6A; CMT2A2A; CMT2A2B
NCBI Protein Information
mitofusin-2
UniProt Protein Name
Mitofusin-2
Protein Family
UniProt Gene Name
MFN2
UniProt Synonym Gene Names
CPRP1; KIAA0214
UniProt Entry Name
MFN2_HUMAN

NCBI Description

This gene encodes a mitochondrial membrane protein that participates in mitochondrial fusion and contributes to the maintenance and operation of the mitochondrial network. This protein is involved in the regulation of vascular smooth muscle cell proliferation, and it may play a role in the pathophysiology of obesity. Mutations in this gene cause Charcot-Marie-Tooth disease type 2A2, and hereditary motor and sensory neuropathy VI, which are both disorders of the peripheral nervous system. Defects in this gene have also been associated with early-onset stroke. Two transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

MFN2: Essential transmembrane GTPase, which mediates mitochondrial fusion. Fusion of mitochondria occurs in many cell types and constitutes an important step in mitochondria morphology, which is balanced between fusion and fission. MFN2 acts independently of the cytoskeleton. It therefore plays a central role in mitochondrial metabolism and may be associated with obesity and/or apoptosis processes. Overexpression induces the formation of mitochondrial networks. Plays an important role in the regulation of vascular smooth muscle cell proliferation. Defects in MFN2 are the cause of Charcot-Marie-Tooth disease type 2A2 (CMT2A2). CMT2A2 is a form of Charcot-Marie-Tooth disease, the most common inherited disorder of the peripheral nervous system. Charcot-Marie-Tooth disease is classified in two main groups on the basis of electrophysiologic properties and histopathology: primary peripheral demyelinating neuropathy or CMT1, and primary peripheral axonal neuropathy or CMT2. Neuropathies of the CMT2 group are characterized by signs of axonal regeneration in the absence of obvious myelin alterations, normal or slightly reduced nerve conduction velocities, and progressive distal muscle weakness and atrophy. Defects in MFN2 are the cause of Charcot-Marie-Tooth disease type 6 (CMT6); also referred to as autosomal dominant hereditary motor and sensory neuropathy VI (HMSN6). CMT6 is an autosomal dominant form of axonal CMT associated with optic atrophy. Belongs to the mitofusin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell cycle regulation; Cytoskeletal; EC 3.6.5.-; Hydrolase; Mitochondrial; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1p36.22

Cellular Component: microtubule cytoskeleton; mitochondrial outer membrane; mitochondrion; integral to membrane; cytosol; intrinsic to mitochondrial outer membrane

Molecular Function: GTPase activity; protein binding; GTP binding; ubiquitin protein ligase binding

Biological Process: mitochondrial fusion; negative regulation of smooth muscle cell proliferation; apoptosis; mitochondrial membrane organization and biogenesis; blastocyst formation; mitochondrion localization; response to unfolded protein; camera-type eye morphogenesis; autophagy; negative regulation of Ras protein signal transduction; cell cycle arrest; blood coagulation; protein targeting to mitochondrion

Disease: Charcot-marie-tooth Disease, Axonal, Type 2a2; Neuropathy, Hereditary Motor And Sensory, Type Vi

Research Articles on MFN2

Similar Products

Product Notes

The MFN2 mfn2 (Catalog #AAA6132296) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MFN2 (Mitofusin 2, Mitofusin-2, CMT2A, CMT2A2, CPRP1, HSG, KIAA0214, MARF, Transmembrane GTPase MFN2) (AP) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MFN2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 5ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MFN2 mfn2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MFN2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.