Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human MFAP4 Monoclonal Antibody | anti-MFAP4 antibody

MFAP4 (Microfibril-associated Glycoprotein 4) (MaxLight 405)

Reactivity
Human
Applications
FLISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MFAP4; Monoclonal Antibody; MFAP4 (Microfibril-associated Glycoprotein 4) (MaxLight 405); anti-MFAP4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3A5
Specificity
Recognizes human MFAP4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-MFAP4 antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa23-122 from human MFAP4 (NP_002395) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SGIRGDALERFCLQQPLDCDDIYAQGYQSDGVYLIYPSGPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTL
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-MFAP4 antibody
Microfibril-associated protein 4 (MFAP4) was initially identified as a gene commonly deleted in the contiguous Smith-Magenis syndrome (SMS) gene. MFAP4 was identified as growth factor to support expansion of hematopoietic stem cells in culture. It is involved in calcium-dependent cell adhesion and intercellular interactions.
Product Categories/Family for anti-MFAP4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31,153 Da
NCBI Official Full Name
microfibril-associated glycoprotein 4 isoform 2
NCBI Official Synonym Full Names
microfibril associated protein 4
NCBI Official Symbol
MFAP4
NCBI Protein Information
microfibril-associated glycoprotein 4
UniProt Protein Name
Microfibril-associated glycoprotein 4
UniProt Gene Name
MFAP4
UniProt Entry Name
MFAP4_HUMAN

NCBI Description

This gene encodes a protein with similarity to a bovine microfibril-associated protein. The protein has binding specificities for both collagen and carbohydrate. It is thought to be an extracellular matrix protein which is involved in cell adhesion or intercellular interactions. The gene is located within the Smith-Magenis syndrome region. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2010]

Uniprot Description

MFAP4: Could be involved in calcium-dependent cell adhesion or intercellular interactions. MFAP4 is deleted in the Smith-Magenis syndrome (SMS).

Protein type: Calcium-binding; Secreted; Cell adhesion; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 17p11.2

Cellular Component: extracellular matrix; microfibril; extracellular region

Molecular Function: protein binding

Biological Process: elastic fiber assembly; extracellular matrix organization and biogenesis; UV protection; fibril organization and biogenesis; cell adhesion

Research Articles on MFAP4

Similar Products

Product Notes

The MFAP4 mfap4 (Catalog #AAA6191156) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MFAP4 (Microfibril-associated Glycoprotein 4) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MFAP4 can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MFAP4 mfap4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MFAP4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.