Mouse anti-Human MESP1 Monoclonal Antibody | anti-MESP1 antibody

MESP1 (Mesoderm Posterior Protein 1, Class C Basic Helix-loop-helix Protein 5, BHLHC5, MGC10676, bHLHc5) (AP)

Cat. Num. AAA6132289

• Gene Names: MESP1; bHLHc5
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MESP1; Monoclonal Antibody; MESP1 (Mesoderm Posterior Protein 1; Class C Basic Helix-loop-helix Protein 5; BHLHC5; MGC10676; bHLHc5) (AP); anti-MESP1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1F9
• Specificity: Recognizes human MESP1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-MESP1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-63 from human MESP1 (NP_061140) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAQPLCPPLSESWMLSAAWGPTRRPPPSDKDCGRSLVSSPDSWGSTPADSPVASPARPGTLRD
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.93kD).)

Western Blot (WB)

(MESP1 monoclonal antibody. Western Blot analysis of MESP1 expression in FHs 173 WE.)

Related Product Information for anti-MESP1 antibody

Transcription factor. Plays a role in the epithelialization of somitic mesoderm and in the development of cardiac mesoderm. Defines the rostrocaudal patterning of the somites by participating in distinct Notch pathways

Product Categories/Family for anti-MESP1 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 14149724
• NCBI GeneID: 55897
• NCBI Accession #: NP_061140.1
• NCBI GenBank Nucleotide #: NM_018670
• UniProt Accession #: Q9BRJ9; Q9NSF1; Q9NSF2
• Molecular Weight: 28.5
• NCBI Official Full Name: mesoderm posterior protein 1
• NCBI Official Synonym Full Names: mesoderm posterior bHLH transcription factor 1
• NCBI Official Symbol: MESP1
• NCBI Official Synonym Symbols: bHLHc5
• NCBI Protein Information: mesoderm posterior protein 1
• UniProt Protein Name: Mesoderm posterior protein 1
• Protein Family: Mesoderm posterior protein
• UniProt Gene Name: MESP1
• UniProt Synonym Gene Names: BHLHC5; bHLHc5

Uniprot Description

MESP1: Transcription factor. Plays a role in the epithelialization of somitic mesoderm and in the development of cardiac mesoderm. Defines the rostrocaudal patterning of the somites by participating in distinct Notch pathways.

Protein type: Cell development/differentiation; Transcription factor

Chromosomal Location of Human Ortholog: 15q26.1

Cellular Component: nucleus

Molecular Function: transcription factor activity

Biological Process: cardiac muscle cell differentiation; endothelial cell differentiation; gastrulation; heart looping; lateral mesoderm development; negative regulation of endodermal cell fate specification; negative regulation of mesodermal cell fate specification; negative regulation of transcription, DNA-dependent; neurogenesis; positive regulation of Notch signaling pathway; positive regulation of striated muscle cell differentiation; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent