Mouse anti-Human MEKK3 Monoclonal Antibody | anti-MEKK3 antibody

MEKK3 (MAPK/ERK Kinase Kinase 3, MEK Kinase 3, MEKK 3, Mitogen-activated Protein Kinase Kinase Kinase 3, MAP3K3, MAPKKK3) (Biotin)

Cat. Num. AAA6142889

• Gene Names: MAP3K3; MEKK3; MAPKKK3
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MEKK3; Monoclonal Antibody; MEKK3 (MAPK/ERK Kinase Kinase 3; MEK Kinase 3; MEKK 3; Mitogen-activated Protein Kinase Kinase Kinase 3; MAP3K3; MAPKKK3) (Biotin); anti-MEKK3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1H3
• Specificity: Recognizes human MAP3K3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-MEKK3 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-89 from human MAP3K3 (AAH10464) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MNEANVMLPYSGKEEPVLPVAMTLPLPGRGPRCGTAATEGGSSFVNAVVSVLQVGVTLMLYPVSKLETVCALWALSTPALGLGLGCIEK
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.53kD).)

Related Product Information for anti-MEKK3 antibody

MEKK3 directly regulates the stress-activated protein kinase (SAPK) and extracellular signal-regulated protein kinase (ERK) pathways by activating SEK and MEK1/2 respectively; it does not regulate the p38 pathway. In cotransfection assays, it enhances transcription from a nuclear factor kappa-B (NFKB)-dependent reporter gene, consistent with a role in the SAPK pathway.

Product Categories/Family for anti-MEKK3 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 14714648
• NCBI GeneID: 4215
• Molecular Weight: 74,089 Da
• NCBI Official Full Name: Homo sapiens mitogen-activated protein kinase kinase kinase 3, mRNA
• NCBI Official Synonym Full Names: mitogen-activated protein kinase kinase kinase 3
• NCBI Official Symbol: MAP3K3
• NCBI Official Synonym Symbols: MEKK3; MAPKKK3
• NCBI Protein Information: mitogen-activated protein kinase kinase kinase 3

NCBI Description

This gene product is a 626-amino acid polypeptide that is 96.5% identical to mouse Mekk3. Its catalytic domain is closely related to those of several other kinases, including mouse Mekk2, tobacco NPK, and yeast Ste11. Northern blot analysis revealed a 4.6-kb transcript that appears to be ubiquitously expressed. This protein directly regulates the stress-activated protein kinase (SAPK) and extracellular signal-regulated protein kinase (ERK) pathways by activating SEK and MEK1/2 respectively; it does not regulate the p38 pathway. In cotransfection assays, it enhanced transcription from a nuclear factor kappa-B (NFKB)-dependent reporter gene, consistent with a role in the SAPK pathway. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]