Mouse anti-Human MEIS2 Monoclonal Antibody | anti-MEIS2 antibody

MEIS2 (Homeobox Protein Meis2, Meis1-related Protein 1, MRG1, MGC2820) (HRP)

Cat. Num. AAA6153492

• Gene Names: MEIS2; MRG1; HsT18361
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MEIS2; Monoclonal Antibody; MEIS2 (Homeobox Protein Meis2; Meis1-related Protein 1; MRG1; MGC2820) (HRP); anti-MEIS2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1H4
• Specificity: Recognizes human MEIS2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-MEIS2 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 1ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-381 from human MEIS2 (AAH01516) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (67.65kD).)

Western Blot (WB)

(MEIS2 monoclonal antibody Western Blot analysis of MEIS2 expression in HeLa.)

Western Blot (WB)

(MEIS2 monoclonal antibody Western Blot analysis of MEIS2 expression in K-562.)

Western Blot (WB)

(Western Blot analysis of MEIS2 expression in transfected 293T cell line by MEIS2 monoclonal antibody. Lane 1: MEIS2 transfected lysate (51.1kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to MEIS2 on formalin-fixed paraffin-embedded human spleen tissue. [antibody concentration 1ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MEIS2 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged MEIS2 is ~0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-MEIS2 antibody

Antibodies; Transcription Factors; Homeobox (HOX)

References

1. Cooperative transcriptional activation by klf4, meis2, and pbx1. Bjerke GA, Hyman-Walsh C, Wotton D.Mol Cell Biol. 2011 Sep;31(18):3723-33. Epub 2011 Jul 11. 2. A neuronal migratory pathway crossing from diencephalon to telencephalon populates amygdala nuclei. Garcia-Moreno F, Pedraza M, Di Giovannantonio LG, Di Salvio M, Lopez-Mascaraque L, Simeone A, De Carlos JA.Nat Neurosci. 2010 Jun;13(6):680-9. Epub 2010 May 23.

NCBI and Uniprot Product Information

• NCBI GI #: 33989064
• NCBI GeneID: 4212
• Molecular Weight: 42,272 Da
• NCBI Official Full Name: Homo sapiens Meis homeobox 2, mRNA
• NCBI Official Synonym Full Names: Meis homeobox 2
• NCBI Official Symbol: MEIS2
• NCBI Official Synonym Symbols: MRG1; HsT18361
• NCBI Protein Information: homeobox protein Meis2
• Protein Family: Homeobox protein

NCBI Description

This gene encodes a homeobox protein belonging to the TALE ('three amino acid loop extension') family of homeodomain-containing proteins. TALE homeobox proteins are highly conserved transcription regulators, and several members have been shown to be essential contributors to developmental programs. Multiple transcript variants encoding distinct isoforms have been described for this gene. [provided by RefSeq, Jul 2008]