Mouse MEF2D Monoclonal Antibody | anti-MEF2D antibody

MEF2D (Myocyte Enhancer Factor 2D, DKFZp686I1536) (HRP)

Cat. Num. AAA6180398

• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: MEF2D; Monoclonal Antibody; MEF2D (Myocyte Enhancer Factor 2D; DKFZp686I1536) (HRP); Myocyte Enhancer Factor 2D; DKFZp686I1536; anti-MEF2D antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3A11
• Specificity: Recognizes MEF2D.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 521

• Applicable Applications for anti-MEF2D antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: MEF2D (NP_005911.1, 256aa-351aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: THSTQLGAPSRKPDLRVITSQAGKGLMHHLTEDHLDLNNAQRLGVSQSTHSLTTPVVSVATPSLLSQGLPFSSMPTAYNTDYQLTSAELSSLPAFS
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(MEF2D monoclonal antibody (M02), clone 3A11 Western Blot analysis of MEF2D expression in K-562 (Cat # L009V1).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MEF2D on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MEF2D on HeLa cell. [antibody concentration 10 ug/ml])

Product Categories/Family for anti-MEF2D antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 5174545
• NCBI GeneID: 4209
• NCBI Accession #: NP_005911.1
• NCBI GenBank Nucleotide #: NP_005911.1
• UniProt Accession #: Q14814
• NCBI Official Full Name: myocyte-specific enhancer factor 2D isoform 1
• NCBI Official Synonym Full Names: myocyte enhancer factor 2D
• NCBI Official Symbol: MEF2D
• NCBI Protein Information: myocyte-specific enhancer factor 2D
• UniProt Protein Name: Myocyte-specific enhancer factor 2D
• Protein Family: Myocyte-specific enhancer factor
• UniProt Gene Name: MEF2D
• UniProt Entry Name: MEF2D_HUMAN

NCBI Description

This gene is a member of the myocyte-specific enhancer factor 2 (MEF2) family of transcription factors. Members of this family are involved in control of muscle and neuronal cell differentiation and development, and are regulated by class II histone deacetylases. Fusions of the encoded protein with Deleted in Azoospermia-Associated Protein 1 (DAZAP1) due to a translocation have been found in an acute lymphoblastic leukemia cell line, suggesting a role in leukemogenesis. The encoded protein may also be involved in Parkinson disease and myotonic dystrophy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2012]

Uniprot Description

MEF2D: transcription factor which binds specifically to the MEF2 element present in the regulatory regions of many muscle-specific genes. May be involved in muscle-specific and/or growth factor-related transcription. Six splice-variant isoforms have been described.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 1q12-q23

Cellular Component: nucleoplasm; intracellular membrane-bound organelle; nucleus

Molecular Function: protein dimerization activity; protein binding; transcription activator binding; histone deacetylase binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; adult heart development; osteoblast differentiation; nervous system development; muscle development; apoptosis; chondrocyte differentiation; positive regulation of transcription from RNA polymerase II promoter; endochondral ossification