Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (MEF2D monoclonal antibody (M03), clone 1B8 Western Blot analysis of MEF2D expression in K-562.)

Mouse MEF2D Monoclonal Antibody | anti-MEF2D antibody

MEF2D (Myocyte Enhancer Factor 2D, DKFZp686I1536) (APC)

Applications
ELISA, Western Blot
Purity
Purified
Synonyms
MEF2D; Monoclonal Antibody; MEF2D (Myocyte Enhancer Factor 2D; DKFZp686I1536) (APC); Myocyte Enhancer Factor 2D; DKFZp686I1536; anti-MEF2D antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1B8
Specificity
Recognizes MEF2D.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
521
Applicable Applications for anti-MEF2D antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
MEF2D (NP_005911.1, 256aa-351aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
THSTQLGAPSRKPDLRVITSQAGKGLMHHLTEDHLDLNNAQRLGVSQSTHSLTTPVVSVATPSLLSQGLPFSSMPTAYNTDYQLTSAELSSLPAFS
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(MEF2D monoclonal antibody (M03), clone 1B8 Western Blot analysis of MEF2D expression in K-562.)

Western Blot (WB) (MEF2D monoclonal antibody (M03), clone 1B8 Western Blot analysis of MEF2D expression in K-562.)
Related Product Information for anti-MEF2D antibody
Mouse monoclonal antibody raised against a partial recombinant MEF2D.
Product Categories/Family for anti-MEF2D antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
myocyte-specific enhancer factor 2D isoform 1
NCBI Official Synonym Full Names
myocyte enhancer factor 2D
NCBI Official Symbol
MEF2D
NCBI Protein Information
myocyte-specific enhancer factor 2D
UniProt Protein Name
Myocyte-specific enhancer factor 2D
UniProt Gene Name
MEF2D
UniProt Entry Name
MEF2D_HUMAN

NCBI Description

This gene is a member of the myocyte-specific enhancer factor 2 (MEF2) family of transcription factors. Members of this family are involved in control of muscle and neuronal cell differentiation and development, and are regulated by class II histone deacetylases. Fusions of the encoded protein with Deleted in Azoospermia-Associated Protein 1 (DAZAP1) due to a translocation have been found in an acute lymphoblastic leukemia cell line, suggesting a role in leukemogenesis. The encoded protein may also be involved in Parkinson disease and myotonic dystrophy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2012]

Uniprot Description

MEF2D: transcription factor which binds specifically to the MEF2 element present in the regulatory regions of many muscle-specific genes. May be involved in muscle-specific and/or growth factor-related transcription. Six splice-variant isoforms have been described.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 1q12-q23

Cellular Component: nucleoplasm; intracellular membrane-bound organelle; nucleus

Molecular Function: protein dimerization activity; protein binding; transcription activator binding; histone deacetylase binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; adult heart development; osteoblast differentiation; nervous system development; muscle development; apoptosis; chondrocyte differentiation; positive regulation of transcription from RNA polymerase II promoter; endochondral ossification

Research Articles on MEF2D

Similar Products

Product Notes

The MEF2D mef2d (Catalog #AAA6167169) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's MEF2D can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MEF2D mef2d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MEF2D, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.