Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: NDE1Sample Tissue: Human NCI-H226 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human NDE1 Polyclonal Antibody | anti-NDE1 antibody

NDE1 Antibody - middle region

Gene Names
NDE1; NDE; LIS4; MHAC; NUDE; NUDE1; HOM-TES-87
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
NDE1; Polyclonal Antibody; NDE1 Antibody - middle region; anti-NDE1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FQEGSREYEAELETQLQQIETRNRDLLSENNRLRMELETIKEKFEVQHSE
Sequence Length
346
Applicable Applications for anti-NDE1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NDE1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NDE1Sample Tissue: Human NCI-H226 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NDE1Sample Tissue: Human NCI-H226 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-NDE1 antibody
This gene encodes a member of the nuclear distribution E (NudE) family of proteins. The encoded protein is localized at the centrosome and interacts with other centrosome components as part of a multiprotein complex that regulates dynein function. This protein plays an essential role in microtubule organization, mitosis and neuronal migration. Mutations in this gene cause lissencephaly 4, a disorder characterized by lissencephaly, severe brain atrophy, microcephaly, and severe mental retardation. Alternative splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38 kDa
NCBI Official Full Name
Nuclear distribution protein nudE homolog 1
NCBI Official Synonym Full Names
nudE neurodevelopment protein 1
NCBI Official Symbol
NDE1
NCBI Official Synonym Symbols
NDE; LIS4; MHAC; NUDE; NUDE1; HOM-TES-87
NCBI Protein Information
nuclear distribution protein nudE homolog 1
UniProt Protein Name
Nuclear distribution protein nudE homolog 1
UniProt Gene Name
NDE1
UniProt Synonym Gene Names
NUDE; NudE
UniProt Entry Name
NDE1_HUMAN

NCBI Description

This gene encodes a member of the nuclear distribution E (NudE) family of proteins. The encoded protein is localized at the centrosome and interacts with other centrosome components as part of a multiprotein complex that regulates dynein function. This protein plays an essential role in microtubule organization, mitosis and neuronal migration. Mutations in this gene cause lissencephaly 4, a disorder characterized by lissencephaly, severe brain atrophy, microcephaly, and severe cognitive disability. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2012]

Uniprot Description

NUDE1: a microtubule-associated protein required for centrosome duplication, and the formation and function of the mitotic spindle. Associated with the centrosome, kinetochore, and spindle. Specifically phosphorylated during M phase, inducing its association with mitotic spindles. Appears to participate in dynein-mediated transport of kinetochore proteins to spindle poles along microtubules. Interacts with gamma tubulin, dynactin, CEP110, dynein,TCP1. PAFAH1B1, PCM-1 and PCNT. Concentrates at the plus ends of microtubules coincident with kinetochores in metaphase and anaphase, and at the cleavage furrow during cytokinesis.Two alternatively spliced human isoforms have been described.

Protein type: Microtubule-binding; Cell cycle regulation; Cytoskeletal

Chromosomal Location of Human Ortholog: 16p13.11

Cellular Component: kinetochore; centrosome; kinesin complex; microtubule; membrane; spindle pole centrosome; cytosol; cleavage furrow

Molecular Function: protein domain specific binding; identical protein binding; protein binding; microtubule binding

Biological Process: cell migration; organelle organization and biogenesis; establishment of chromosome localization; neuron migration; microtubule nucleation; chromosome segregation; mitotic centrosome separation; centrosome localization; establishment of mitotic spindle orientation; cell division; neuroblast proliferation; vesicle transport along microtubule; mitotic cell cycle; cerebral cortex development; G2/M transition of mitotic cell cycle; centrosome duplication

Disease: Lissencephaly 4; Microhydranencephaly

Research Articles on NDE1

Similar Products

Product Notes

The NDE1 nde1 (Catalog #AAA3221712) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NDE1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NDE1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NDE1 nde1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FQEGSREYEA ELETQLQQIE TRNRDLLSEN NRLRMELETI KEKFEVQHSE. It is sometimes possible for the material contained within the vial of "NDE1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.