Mouse anti-Human MED8 Monoclonal Antibody | anti-MED8 antibody

MED8 (Mediator of RNA Polymerase II Transcription Subunit 8, Activator-recruited Cofactor 32kD Component, Mediator Complex Subunit 8, MGC17544, MGC19641) APC

Cat. Num. AAA6137578

• Gene Names: MED8; ARC32
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MED8; Monoclonal Antibody; MED8 (Mediator of RNA Polymerase II Transcription Subunit 8; Activator-recruited Cofactor 32kD Component; Mediator Complex Subunit 8; MGC17544; MGC19641) APC; anti-MED8 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1D3
• Specificity: Recognizes human MED8.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-MED8 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-60 from human MED8 (NP_443109) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MRQTEGRVPVFSHEVVPDHLRTKPDPEVEEQEKQLTTDAARIGADAAQKQIQSLNKMCS
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.6kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MED8 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged MED8 is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-MED8 antibody

Antibodies; Enzymes; Polymerase

NCBI and Uniprot Product Information

• NCBI GI #: 155030190
• NCBI GeneID: 112950
• NCBI Accession #: NP_443109
• NCBI GenBank Nucleotide #: NM_052877
• UniProt Accession #: Q96G25; Q5JUY8; Q96FQ4; A9IZ91; A9IZ92
• Molecular Weight: 19,002 Da
• NCBI Official Full Name: mediator of RNA polymerase II transcription subunit 8 isoform 3
• NCBI Official Synonym Full Names: mediator complex subunit 8
• NCBI Official Symbol: MED8
• NCBI Official Synonym Symbols: ARC32
• NCBI Protein Information: mediator of RNA polymerase II transcription subunit 8; activator-recruited cofactor 32 kDa component; mediator of RNA polymerase II transcription subunit MED8
• UniProt Protein Name: Mediator of RNA polymerase II transcription subunit 8
• Protein Family: Mediator of RNA polymerase II transcription
• UniProt Gene Name: MED8
• UniProt Synonym Gene Names: ARC32
• UniProt Entry Name: MED8_HUMAN

Uniprot Description

MED8: Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. May play a role as a target recruitment subunit in E3 ubiquitin-protein ligase complexes and thus in ubiquitination and subsequent proteasomal degradation of target proteins. Belongs to the Mediator complex subunit 8 family. 3 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 1p34.2

Cellular Component: nucleoplasm; Srb-mediator complex

Molecular Function: protein binding

Biological Process: regulation of transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase II promoter; protein ubiquitination; gene expression