Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human MED26 Monoclonal Antibody | anti-MED26 antibody

MED26 (Mediator of RNA Polymerase II Transcription Subunit 26, Activator-recruited Cofactor 70kD Component, ARC70, Cofactor Required for Sp1 Transcriptional Activation Subunit 7, CRSP Complex Subunit 7, Mediator Complex Subunit 26, Transcriptional Coactiv

Gene Names
MED26; CRSP7; CRSP70
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MED26; Monoclonal Antibody; MED26 (Mediator of RNA Polymerase II Transcription Subunit 26; Activator-recruited Cofactor 70kD Component; ARC70; Cofactor Required for Sp1 Transcriptional Activation Subunit 7; CRSP Complex Subunit 7; Mediator Complex Subunit 26; Transcriptional Coactiv; anti-MED26 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2G10
Specificity
Recognizes human CRSP7.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-MED26 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 1.5ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa501-600 from CRSP7 (NP_004822) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GAQTPGAHHFMSEYLKQEESTRQGARQLHVLVPQSPPTDLPGLTREVTQDDLDRIQASQWPGVNGCQDTQGNWYDWTQCISLDPHGDDGRLNILPYVCLD
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(Western Blot analysis of CRSP7 expression in transfected 293T cell line by CRSP7 monoclonal antibody. Lane 1: CRSP7 transfected lysate (65.446kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CRSP7 expression in transfected 293T cell line by CRSP7 monoclonal antibody. Lane 1: CRSP7 transfected lysate (65.446kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to MED26 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1.5ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to MED26 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1.5ug/ml])
Product Categories/Family for anti-MED26 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65kDa
NCBI Official Full Name
mediator of RNA polymerase II transcription subunit 26
NCBI Official Synonym Full Names
mediator complex subunit 26
NCBI Official Symbol
MED26
NCBI Official Synonym Symbols
CRSP7; CRSP70
NCBI Protein Information
mediator of RNA polymerase II transcription subunit 26
UniProt Protein Name
Mediator of RNA polymerase II transcription subunit 26
UniProt Gene Name
MED26
UniProt Synonym Gene Names
ARC70; CRSP7; ARC70
UniProt Entry Name
MED26_HUMAN

NCBI Description

The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. [provided by RefSeq, Jul 2008]

Uniprot Description

MED26: Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Belongs to the Mediator complex subunit 26 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 19p13.11

Cellular Component: nucleoplasm; Srb-mediator complex

Molecular Function: protein binding; DNA binding; transcription coactivator activity

Biological Process: regulation of transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase II promoter; gene expression

Research Articles on MED26

Similar Products

Product Notes

The MED26 med26 (Catalog #AAA6148181) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MED26 (Mediator of RNA Polymerase II Transcription Subunit 26, Activator-recruited Cofactor 70kD Component, ARC70, Cofactor Required for Sp1 Transcriptional Activation Subunit 7, CRSP Complex Subunit 7, Mediator Complex Subunit 26, Transcriptional Coactiv reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MED26 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 1.5ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MED26 med26 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MED26, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.