Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.85kD).)

Mouse anti-Human MED17 Monoclonal Antibody | anti-MED17 antibody

MED17 (ARC77, CRSP6, DRIP77, DRIP80, TRAP80, Mediator of RNA Polymerase II Transcription Subunit 17, Activator-recruited Cofactor 77kD Component, Cofactor Required for Sp1 Transcriptional Activation Subunit 6, Mediator Complex Subunit 17, Thyroid Hormone

Gene Names
MED17; CRSP6; CRSP77; DRIP80; TRAP80
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MED17; Monoclonal Antibody; MED17 (ARC77; CRSP6; DRIP77; DRIP80; TRAP80; Mediator of RNA Polymerase II Transcription Subunit 17; Activator-recruited Cofactor 77kD Component; Cofactor Required for Sp1 Transcriptional Activation Subunit 6; Mediator Complex Subunit 17; Thyroid Hormone; anti-MED17 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4D4
Specificity
Recognizes human CRSP6.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-MED17 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa551-651 from CRSP6 (AAH21101) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FSNHVGLGPIESIGNASAITVASPSGDYAISVRNGPESGSKIMVQFPRNQCKDLPKSDVLQDNKWSHLRGPFKEVQWNKMEGRNFVYKMELLMSALSPCLL
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.85kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.85kD).)

Western Blot (WB)

(CRSP6 monoclonal antibody Western Blot analysis of CRSP6 expression in Hela NE.)

Western Blot (WB) (CRSP6 monoclonal antibody Western Blot analysis of CRSP6 expression in Hela NE.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CRSP6 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.2ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to CRSP6 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.2ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CRSP6 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to CRSP6 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged CRSP6 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CRSP6 is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-MED17 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
15,951 Da
NCBI Official Full Name
Homo sapiens mediator complex subunit 17, mRNA
NCBI Official Synonym Full Names
mediator complex subunit 17
NCBI Official Symbol
MED17
NCBI Official Synonym Symbols
CRSP6; CRSP77; DRIP80; TRAP80
NCBI Protein Information
mediator of RNA polymerase II transcription subunit 17

NCBI Description

The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. [provided by RefSeq, Jul 2008]

Research Articles on MED17

Similar Products

Product Notes

The MED17 (Catalog #AAA6158786) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MED17 (ARC77, CRSP6, DRIP77, DRIP80, TRAP80, Mediator of RNA Polymerase II Transcription Subunit 17, Activator-recruited Cofactor 77kD Component, Cofactor Required for Sp1 Transcriptional Activation Subunit 6, Mediator Complex Subunit 17, Thyroid Hormone reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MED17 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MED17 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MED17, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.