Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.79kD).)

Mouse anti-Human MED15 Monoclonal Antibody | anti-MED15 antibody

MED15 (PCQAP, Mediator of RNA Polymerase II Transcription Subunit 15, Mediator Complex Subunit 15, Positive Cofactor 2 Glutamine/Q-rich-associated Protein, PC2 Glutamine/Q-rich-associated Protein, TPA-inducible Gene 1 Protein, TIG-1, Activator-recruited C

Gene Names
MED15; TIG1; CAG7A; CTG7A; PCQAP; TIG-1; TNRC7; ARC105
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MED15; Monoclonal Antibody; MED15 (PCQAP; Mediator of RNA Polymerase II Transcription Subunit 15; Mediator Complex Subunit 15; Positive Cofactor 2 Glutamine/Q-rich-associated Protein; PC2 Glutamine/Q-rich-associated Protein; TPA-inducible Gene 1 Protein; TIG-1; Activator-recruited C; anti-MED15 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4A4
Specificity
Recognizes human PCQAP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
748
Applicable Applications for anti-MED15 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-89 from human PCQAP (NP_056973) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MDVSGQETDWRSTAFRQKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQSL*
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.79kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.79kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PCQAP on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to PCQAP on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged MED15 is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MED15 is 0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-MED15 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
mediator of RNA polymerase II transcription subunit 15 isoform b
NCBI Official Synonym Full Names
mediator complex subunit 15
NCBI Official Symbol
MED15
NCBI Official Synonym Symbols
TIG1; CAG7A; CTG7A; PCQAP; TIG-1; TNRC7; ARC105
NCBI Protein Information
mediator of RNA polymerase II transcription subunit 15
UniProt Protein Name
Mediator of RNA polymerase II transcription subunit 15
UniProt Gene Name
MED15
UniProt Synonym Gene Names
ARC105; CTG7A; PCQAP; TIG1; TNRC7; ARC105; PC2 glutamine/Q-rich-associated protein; TIG-1
UniProt Entry Name
MED15_HUMAN

NCBI Description

The protein encoded by this gene is a subunit of the multiprotein complexes PC2 and ARC/DRIP and may function as a transcriptional coactivator in RNA polymerase II transcription. This gene contains stretches of trinucleotide repeats and is located in the chromosome 22 region which is deleted in DiGeorge syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2014]

Uniprot Description

PCQAP: Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Required for cholesterol-dependent gene regulation. Positively regulates the Nodal signaling pathway. Belongs to the Mediator complex subunit 15 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription, coactivator/corepressor; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 22q11.2

Cellular Component: nucleoplasm; membrane; cytoplasm; Srb-mediator complex; nucleus

Molecular Function: protein binding

Biological Process: regulation of transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase II promoter; stem cell maintenance; gene expression

Research Articles on MED15

Similar Products

Product Notes

The MED15 med15 (Catalog #AAA6148740) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MED15 (PCQAP, Mediator of RNA Polymerase II Transcription Subunit 15, Mediator Complex Subunit 15, Positive Cofactor 2 Glutamine/Q-rich-associated Protein, PC2 Glutamine/Q-rich-associated Protein, TPA-inducible Gene 1 Protein, TIG-1, Activator-recruited C reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MED15 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MED15 med15 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MED15, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.