Mouse MECP2 Monoclonal Antibody | anti-MECP2 antibody

MECP2 (methyl CpG Binding Protein 2 (Rett Syndrome), AUTSX3, DKFZp686A24160, MRX16, MRX79, MRXS13, MRXSL, PPMX, RTS, RTT) (FITC)

Cat. Num. AAA6176553

• Gene Names: MECP2; RS; RTS; RTT; PPMX; MRX16; MRX79; MRXSL; AUTSX3; MRXS13
• Applications: Immunohistochemistry, Western Blot
• Purity: Purified
• Synonyms: MECP2; Monoclonal Antibody; MECP2 (methyl CpG Binding Protein 2 (Rett Syndrome); AUTSX3; DKFZp686A24160; MRX16; MRX79; MRXS13; MRXSL; PPMX; RTS; RTT) (FITC); methyl CpG Binding Protein 2 (Rett Syndrome); RTT; anti-MECP2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1B11
• Specificity: Recognizes MECP2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 486

• Applicable Applications for anti-MECP2 antibody: Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: MECP2 (AAH11612, 81aa-170aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQ
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.; ; FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(MECP2 monoclonal antibody (M03), clone 1B11 Western Blot analysis of MECP2 expression in Hela S3 NE (Cat # L013V3).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to MECP2 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to MECP2 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 3 ug/ml])

Western Blot (WB)

(MECP2 monoclonal antibody (M03), clone 1B11. Western Blot analysis of MECP2 expression in Jurkat (Cat # L017V1).)

Testing Data

(Detection limit for recombinant GST tagged MECP2 is approximately 0.1ng/ml as a capture antibody.)

Related Product Information for anti-MECP2 antibody

DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. In contrast to other MBD family members, MECP2 is X-linked and subject to X inactivation. MECP2 is dispensible in stem cells, but is essential for embryonic development. MECP2 gene mutations are the cause of most cases of Rett syndrome, a progressive neurologic developmental disorder and one of the most common causes of mental retardation in females. [provided by RefSeq]

Product Categories/Family for anti-MECP2 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 15079580
• NCBI GeneID: 4204
• NCBI Official Full Name: Methyl CpG binding protein 2 (Rett syndrome)
• NCBI Official Synonym Full Names: methyl-CpG binding protein 2
• NCBI Official Symbol: MECP2
• NCBI Official Synonym Symbols: RS; RTS; RTT; PPMX; MRX16; MRX79; MRXSL; AUTSX3; MRXS13
• NCBI Protein Information: methyl-CpG-binding protein 2
• Protein Family: Methyl-CpG-binding protein

NCBI Description

DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. In contrast to other MBD family members, MECP2 is X-linked and subject to X inactivation. MECP2 is dispensible in stem cells, but is essential for embryonic development. MECP2 gene mutations are the cause of most cases of Rett syndrome, a progressive neurologic developmental disorder and one of the most common causes of cognitive disability in females. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Oct 2015]