Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase on formalin-fixed paraffin-embedded human placenta in (3ug/ml).)

Mouse anti-Human MDA5 Monoclonal Antibody | anti-MDA5 antibody

MDA5 (Melanoma Differentiation-associated Protein 5, MDA-5, Interferon-induced Helicase C Domain-containing Protein 1, Clinically Amyopathic Dermatomyositis Autoantigen 140kD, CADM-140 Autoantigen, Helicase with 2 CARD Domains, Helicard, Hlcd, IDDM19, Int

Gene Names
IFIH1; Hlcd; MDA5; MDA-5; RLR-2; IDDM19
Reactivity
Human
Applications
Immunohistochemistry
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MDA5; Monoclonal Antibody; MDA5 (Melanoma Differentiation-associated Protein 5; MDA-5; Interferon-induced Helicase C Domain-containing Protein 1; Clinically Amyopathic Dermatomyositis Autoantigen 140kD; CADM-140 Autoantigen; Helicase with 2 CARD Domains; Helicard; Hlcd; IDDM19; Int; anti-MDA5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3F6
Specificity
Recognizes human MDA5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-MDA5 antibody
FLISA, Immunohistochemistry (IHC)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa928-1023 of human MDA5 (NM_022168; NP_071451.2) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HVNMTPEFKELYIVRENKALQKKCADYQINGEIICKCGQAWGTMMVHKGLDLPCLKIRNFVVVFKNNSTKKQYKKWVELPITFPNLDYSECCLFSD
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Immunoperoxidase on formalin-fixed paraffin-embedded human placenta in (3ug/ml).)

Testing Data (Immunoperoxidase on formalin-fixed paraffin-embedded human placenta in (3ug/ml).)

Testing Data

(Detection limit for is 3ng/ml as a capture antibody.)

Testing Data (Detection limit for is 3ng/ml as a capture antibody.)
Related Product Information for anti-MDA5 antibody
MaxLight490 is a new Blue-Green photostable dye conjugate comparable to DyLight488, Alexa Fluor488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000.
Product Categories/Family for anti-MDA5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
interferon-induced helicase C domain-containing protein 1
NCBI Official Synonym Full Names
interferon induced with helicase C domain 1
NCBI Official Symbol
IFIH1
NCBI Official Synonym Symbols
Hlcd; MDA5; MDA-5; RLR-2; IDDM19
NCBI Protein Information
interferon-induced helicase C domain-containing protein 1; helicard; CADM-140 autoantigen; RIG-I-like receptor 2; helicase with 2 CARD domains; RNA helicase-DEAD box protein 116; murabutide down-regulated protein; DEAD/H (Asp-Glu-Ala-Asp/His) box polypept
UniProt Protein Name
Interferon-induced helicase C domain-containing protein 1
UniProt Gene Name
IFIH1
UniProt Synonym Gene Names
MDA5; RH116; CADM-140 autoantigen; Helicard; MDA-5; RLR-2
UniProt Entry Name
IFIH1_HUMAN

NCBI Description

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein that is upregulated in response to treatment with beta-interferon and a protein kinase C-activating compound, mezerein. Irreversible reprogramming of melanomas can be achieved by treatment with both these agents; treatment with either agent alone only achieves reversible differentiation. Genetic variation in this gene is associated with diabetes mellitus insulin-dependent type 19. [provided by RefSeq, Jul 2012]

Uniprot Description

IFIH1: Innate immune receptor which acts as a cytoplasmic sensor of viral nucleic acids and plays a major role in sensing viral infection and in the activation of a cascade of antiviral responses including the induction of type I interferons and proinflammatory cytokines. Its ligands include mRNA lacking 2'-O- methylation at their 5' cap and long-dsRNA (>1 kb in length). Upon ligand binding it associates with mitochondria antiviral signaling protein (MAVS/IPS1) which activates the IKK-related kinases: TBK1 and IKBKE which phosphorylate interferon regulatory factors: IRF3 and IRF7 which in turn activate transcription of antiviral immunological genes, including interferons (IFNs); IFN-alpha and IFN-beta. Responsible for detecting the Picornaviridae family members such as encephalomyocarditis virus (EMCV) and mengo encephalomyocarditis virus (ENMG). Can also detect other viruses such as dengue virus (DENV), west Nile virus (WNV), and reovirus. Also involved in antiviral signaling in response to viruses containing a dsDNA genome, such as vaccinia virus. Plays an important role in amplifying innate immune signaling through recognition of RNA metabolites that are produced during virus infection by ribonuclease L (RNase L). May play an important role in enhancing natural killer cell function and may be involved in growth inhibition and apoptosis in several tumor cell lines. Monomer in the absence of ligands and homodimerizes in the presence of dsRNA ligands. Can assemble into helical or linear polymeric filaments on long dsRNA. Interacts with MAVS/IPS1. Interacts with V protein of Simian virus 5, Human parainfluenza virus 2, Mumps virus, Sendai virus and Hendra virus. Binding to paramyxoviruses V proteins prevents IFN-beta induction, and the further establishment of an antiviral state. Interacts with PCBP2. Interacts with NLRC5. Interacts with PIAS2-beta. Interacts with DDX60. By interferon (IFN) and TNF. Widely expressed, at a low level. Expression is detected at slightly highest levels in placenta, pancreas and spleen and at barely levels in detectable brain, testis and lung. Belongs to the helicase family. RLR subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Apoptosis; EC 3.6.4.13; Helicase

Chromosomal Location of Human Ortholog: 2q24

Cellular Component: nucleus; cytosol

Molecular Function: ribonucleoprotein binding; protein binding; single-stranded RNA binding; DNA binding; zinc ion binding; double-stranded RNA binding; helicase activity; ATP binding

Biological Process: regulation of apoptosis; protein sumoylation; detection of virus; viral reproduction; response to virus; positive regulation of interferon-beta production; innate immune response; negative regulation of interferon type I production; positive regulation of interferon-alpha production

Disease: Aicardi-goutieres Syndrome 7; Singleton-merten Syndrome 1

Research Articles on MDA5

Similar Products

Product Notes

The MDA5 ifih1 (Catalog #AAA6201345) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MDA5 (Melanoma Differentiation-associated Protein 5, MDA-5, Interferon-induced Helicase C Domain-containing Protein 1, Clinically Amyopathic Dermatomyositis Autoantigen 140kD, CADM-140 Autoantigen, Helicase with 2 CARD Domains, Helicard, Hlcd, IDDM19, Int reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MDA5 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunohistochemistry (IHC). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MDA5 ifih1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MDA5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.