<
Western Blot (WB)
(MCM3 monoclonal antibody (M04), clone 2H3. Western Blot analysis of MCM3 expression in Hela S3 NE (Cat # L013V3).)
Mouse MCM3 Monoclonal Antibody | anti-MCM3 antibody
MCM3 (Minichromosome Maintenance Complex Component 3, HCC5, MGC1157, P1-MCM3, P1.h, RLFB) (Biotin)
Gene Names
MCM3; HCC5; P1.h; RLFB; P1-MCM3
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
MCM3; Monoclonal Antibody; MCM3 (Minichromosome Maintenance Complex Component 3; HCC5; MGC1157; P1-MCM3; P1.h; RLFB) (Biotin); Minichromosome Maintenance Complex Component 3; RLFB; anti-MCM3 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2H3
Specificity
Recognizes MCM3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-MCM3 antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
MCM3 (NP_002379, 699aa-808aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AKDGDSYDPYDFSDTEEEMPQVHTPKTADSQETKESQKVELSESRLKAFKVALLDVFREAHAQSIGMNRLTESINRDSEEPFSSVEIQAALSKMQDDNQVMVSEGIIFLI
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(MCM3 monoclonal antibody (M04), clone 2H3. Western Blot analysis of MCM3 expression in Hela S3 NE (Cat # L013V3).)
Western Blot (WB)
(MCM3 monoclonal antibody (M04), clone 2H3. Western Blot analysis of MCM3 expression in Hela S3 NE (Cat # L013V3).)
Western Blot (WB)
(MCM3 monoclonal antibody (M04), clone 2H3. Western Blot analysis of MCM3 expression in human ovarian cancer.)
Western Blot (WB)
(MCM3 monoclonal antibody (M04), clone 2H3. Western Blot analysis of MCM3 expression in human ovarian cancer.)
Western Blot (WB)
(MCM3 monoclonal antibody (M04), clone 2H3. Western Blot analysis of MCM3 expression in Y-79 (Cat # L042V1).)
Western Blot (WB)
(MCM3 monoclonal antibody (M04), clone 2H3. Western Blot analysis of MCM3 expression in Y-79 (Cat # L042V1).)
Testing Data
(Detection limit for recombinant GST tagged MCM3 is approximately 0.1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged MCM3 is approximately 0.1ng/ml as a capture antibody.)
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to MCM3 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to MCM3 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to MCM3 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to MCM3 on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-MCM3 antibody
The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with, and thus is acetlyated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression. [provided by RefSeq]
Product Categories/Family for anti-MCM3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
95,908 Da
NCBI Official Full Name
DNA replication licensing factor MCM3 isoform 1
NCBI Official Synonym Full Names
minichromosome maintenance complex component 3
NCBI Official Symbol
MCM3
NCBI Official Synonym Symbols
HCC5; P1.h; RLFB; P1-MCM3
NCBI Protein Information
DNA replication licensing factor MCM3; DNA polymerase alpha holoenzyme-associated protein P1; DNA replication factor MCM3; MCM3 minichromosome maintenance deficient 3; RLF subunit beta; cervical cancer proto-oncogene 5; hRlf beta subunit; p102; replicatio
UniProt Protein Name
DNA replication licensing factor MCM3
Protein Family
UniProt Gene Name
MCM3
UniProt Entry Name
MCM3_HUMAN
Uniprot Description
MCM3: a mini-chromosome maintenance protein, essential for the initiation of eukaryotic genome replication. Allows DNA to undergo a single round of replication per cell cycle. Required for DNA replication and cell proliferation.
Protein type: EC 3.6.4.12; DNA replication
Chromosomal Location of Human Ortholog: 6p12
Cellular Component: nucleoplasm; centrosome; alpha DNA polymerase:primase complex; membrane; intracellular membrane-bound organelle; MCM complex; perinuclear region of cytoplasm; nucleus
Molecular Function: DNA helicase activity; protein binding; DNA binding; ATP binding
Biological Process: DNA replication initiation; mitotic cell cycle; DNA strand elongation during DNA replication; DNA replication; DNA duplex unwinding; G1/S transition of mitotic cell cycle
Similar Products
Product Notes
The MCM3 mcm3 (Catalog #AAA6172489) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's MCM3 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MCM3 mcm3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MCM3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
