Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against immunogen (67.76kD).)

Mouse anti-Human MBNL1 Monoclonal Antibody | anti-MBNL1 antibody

MBNL1 (Muscleblind-like Protein 1, Triplet-expansion RNA-binding Protein, EXP, KIAA0428, MBNL)

Gene Names
MBNL1; EXP; MBNL; EXP35; EXP40; EXP42
Reactivity
Human
Applications
ELISA, Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
MBNL1; Monoclonal Antibody; MBNL1 (Muscleblind-like Protein 1; Triplet-expansion RNA-binding Protein; EXP; KIAA0428; MBNL); Anti -MBNL1 (Muscleblind-like Protein 1; anti-MBNL1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3E7
Specificity
Recognizes human MBNL1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAVSVTPIRDTKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLKGRCSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLIRTDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMGIPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPGSILCMTPATSVVPMVHGATPATVSAATTSATSVPFAATATANQIPIISAEHLTSHKYVTQM
Applicable Applications for anti-MBNL1 antibody
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry.
Dilution: Immunofluorescence: 10ug/ml
Immunohistochemistry (Formalin fixed paraffin embedded): 0.75ug/ml
Immunogen
Full length recombinant corresponding to aa1-382 from human MBNL1 (AAH43493) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against immunogen (67.76kD).)

Western Blot (WB) (Western Blot detection against immunogen (67.76kD).)

Western Blot (WB)

(Western Blot analysis of MBNL1 expression in Hela NE using MBS6012546.)

Western Blot (WB) (Western Blot analysis of MBNL1 expression in Hela NE using MBS6012546.)

Testing Data

Testing Data

Immunofluorescence (IF)

(Immunofluorescence to MBNL1 on HeLa cell using MBS6012546 (10ug/ml).)

Immunofluorescence (IF) (Immunofluorescence to MBNL1 on HeLa cell using MBS6012546 (10ug/ml).)

Testing Data

(Detection limit for recombinant GST tagged MBNL1 is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MBNL1 is ~3ng/ml as a capture antibody.)
Related Product Information for anti-MBNL1 antibody
Mediates pre-mRNA alternative splicing regulation. Acts either as activator or repressor of splicing on specific pre-mRNA targets. Inhibits cardiac troponin-T (TNNT2) pre-mRNA exon inclusion but induces insulin receptor (IR) pre-mRNA exon inclusion in muscle. Antagonizes the alternative splicing activity pattern of CELF proteins. Regulates the TNNT2 exon 5 skipping through competition with U2AF2. Inhibits the formation of the spliceosome A complex on intron 4 of TNNT2 pre-mRNA. Binds to the stem-loop structure within the polypyrimidine tract of TNNT2 intron 4 during spliceosome assembly. Binds to the 5'-YGCU(U/G)Y-3'consensus sequence. Binds to the IR RNA. Binds to expanded CUG repeat RNA, which folds into a hairpin structure containing GC base pairs and bulged, unpaired U residues.
Product Categories/Family for anti-MBNL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41,817 Da
NCBI Official Full Name
muscleblind-like protein 1 isoform g
NCBI Official Synonym Full Names
muscleblind-like splicing regulator 1
NCBI Official Symbol
MBNL1
NCBI Official Synonym Symbols
EXP; MBNL; EXP35; EXP40; EXP42
NCBI Protein Information
muscleblind-like protein 1; triplet-expansion RNA-binding protein
UniProt Protein Name
Muscleblind-like protein 1
Protein Family
UniProt Gene Name
MBNL1
UniProt Synonym Gene Names
EXP; KIAA0428; MBNL
UniProt Entry Name
MBNL1_HUMAN

Uniprot Description

MBNL1: Mediates pre-mRNA alternative splicing regulation. Acts either as activator or repressor of splicing on specific pre-mRNA targets. Inhibits cardiac troponin-T (TNNT2) pre-mRNA exon inclusion but induces insulin receptor (IR) pre-mRNA exon inclusion in muscle. Antagonizes the alternative splicing activity pattern of CELF proteins. Regulates the TNNT2 exon 5 skipping through competition with U2AF2. Inhibits the formation of the spliceosome A complex on intron 4 of TNNT2 pre-mRNA. Binds to the stem-loop structure within the polypyrimidine tract of TNNT2 intron 4 during spliceosome assembly. Binds to the 5'-YGCU(U/G)Y- 3'consensus sequence. Binds to the IR RNA. Binds to expanded CUG repeat RNA, which folds into a hairpin structure containing GC base pairs and bulged, unpaired U residues. Plays a role in the pathogenesis of dystrophia myotonica type 1 (DM1). A muscular disorder characterized by myotonia, muscle wasting in the distal extremities, cataract, hypogonadism, defective endocrine functions, male baldness and cardiac arrhythmias. In muscle cells from DM1 patients, MBNL1 is sequestered by DMPK RNAs containing CUG triplet repeat expansions. MBNL1 binding is proportional to repeat length consistent with the direct correlation between the length of repeat expansion and disease severity. Belongs to the muscleblind family. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA splicing; RNA-binding

Chromosomal Location of Human Ortholog: 3q25

Cellular Component: nucleoplasm; centrosome; stress granule; cytoplasm; nucleus

Molecular Function: protein binding; RNA binding; metal ion binding; double-stranded RNA binding

Biological Process: alternative nuclear mRNA splicing, via spliceosome; myoblast differentiation; nervous system development; mRNA splice site selection; skeletal muscle development; regulation of RNA splicing; in utero embryonic development; RNA splicing; regulation of alternative nuclear mRNA splicing, via spliceosome; embryonic limb morphogenesis

Research Articles on MBNL1

Similar Products

Product Notes

The MBNL1 mbnl1 (Catalog #AAA6012546) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MBNL1 (Muscleblind-like Protein 1, Triplet-expansion RNA-binding Protein, EXP, KIAA0428, MBNL) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MBNL1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF). Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 0.75ug/ml. Researchers should empirically determine the suitability of the MBNL1 mbnl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAVSVTPIRD TKWLTLEVCR EFQRGTCSRP DTECKFAHPS KSCQVENGRV IACFDSLKGR CSRENCKYLH PPPHLKTQLE INGRNNLIQQ KNMAMLAQQM QLANAMMPGA PLQPVPMFSV APSLATNASA AAFNPYLGPV SPSLVPAEIL PTAPMLVTGN PGVPVPAAAA AAAQKLIRTD RLEVCREYQR GNCNRGENDC RFAHPADSTM IDTNDNTVTV CMDYIKGRCS REKCKYFHPP AHLQAKIKAA QYQVNQAAAA QAAATAAAMG IPQAVLPPLP KRPALEKTNG ATAVFNTGIF QYQQALANMQ LQQHTAFLPP GSILCMTPAT SVVPMVHGAT PATVSAATTS ATSVPFAATA TANQIPIISA EHLTSHKYVT QM. It is sometimes possible for the material contained within the vial of "MBNL1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.