Mouse anti-Human MAPKSP1 Monoclonal Antibody | anti-lamtor3 antibody

MAPKSP1 (LAMTOR3, MAP2K1IP1, MAPKSP1, Ragulator Complex Protein LAMTOR3, Late Endosomal/Lysosomal Adaptor and MAPK and MTOR Activator 3, MEK-binding Partner 1, Mp1, Mitogen-activated Protein Kinase Kinase 1-interacting Protein 1, Mitogen-activated Protein

Cat. Num. AAA6007266

• Gene Names: lamtor3; mapksp1; zgc:110207
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: MAPKSP1; Monoclonal Antibody; MAPKSP1 (LAMTOR3; MAP2K1IP1; Ragulator Complex Protein LAMTOR3; Late Endosomal/Lysosomal Adaptor and MAPK and MTOR Activator 3; MEK-binding Partner 1; Mp1; Mitogen-activated Protein Kinase Kinase 1-interacting Protein 1; Mitogen-activated Protein; Anti -MAPKSP1 (LAMTOR3; anti-lamtor3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2A4
• Specificity: Recognizes human MAPKSP1.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLP*

• Applicable Applications for anti-lamtor3 antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Partial recombinant corresponding to aa1-88 from MAPKSP1 (NP_068805) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.31kD).)

Western Blot (WB)

(Western Blot analysis of MAPKSP1 expression in transfected 293T cell line by MAPKSP1 monoclonal antibody |Lane 1: MAPKSP1 transfected lysate (13.623kD).|Lane 2: Non-transfected lysate.)

Related Product Information for anti-lamtor3 antibody

MAPKSP1 (Mitogen-activated protein kinase scaffold protein 1) is a scaffold protein that functions in the extracellular signal-regulated kinase (ERK) cascade. The protein is localized to late endosomes by the mitogen-activated protein-binding protein-interacting protein, and binds specifically to MAP kinase kinase MAP2K1/MEK1, MAP kinase MAPK3/ERK1, and MAP kinase MAPK1/ERK2.

Product Categories/Family for anti-lamtor3 antibody

Antibodies; Abs to Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 182891646
• NCBI GeneID: 553597
• UniProt Accession #: Q503S6
• Molecular Weight: 13,677 Da
• NCBI Official Full Name: Mapksp1 protein
• NCBI Official Synonym Full Names: late endosomal/lysosomal adaptor, MAPK and MTOR activator 3
• NCBI Official Symbol: lamtor3
• NCBI Official Synonym Symbols: mapksp1; zgc:110207
• NCBI Protein Information: ragulator complex protein LAMTOR3; MAPK scaffold protein 1; mitogen-activated protein kinase scaffold protein 1; late endosomal/lysosomal adaptor and MAPK and MTOR activator 3; mitogen-activated protein kinase kinase 1-interacting protein 1
• UniProt Protein Name: Ragulator complex protein LAMTOR3
• Protein Family: Ragulator complex protein
• UniProt Gene Name: lamtor3
• UniProt Synonym Gene Names: mapksp1
• UniProt Entry Name: LTOR3_DANRE

Uniprot Description

Function: Regulator of the TOR pathway, a signaling cascade that promotes cell growth in response to growth factors, energy levels, and amino acids. As part of the Ragulator complex, may activate the TOR signaling cascade in response to amino acids. Adapter protein that may regulate the MAP kinase cascade

By similarity.

Subunit structure: Part of the Ragulator complex composed of lamtor1, lamtor2, lamtor3, lamtor4 and lamtor5

By similarity.

Subcellular location: Late endosome membrane; Peripheral membrane protein; Cytoplasmic side

By similarity.

Sequence similarities: Belongs to the LAMTOR3 family.