Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (MAPKAPK3 monoclonal antibody Western Blot analysis of MAPKAPK3 expression in HeLa.)

Mouse anti-Human, Mouse MAPKAPK3 Monoclonal Antibody | anti-MAPKAPK3 antibody

MAPKAPK3 (Mitogen-activated Protein Kinase-activated Protein Kinase 3, MAP Kinase-activated Protein Kinase 3, MAPK-activated Protein Kinase 3, MAPKAP Kinase 3, MAPKAPK-3, Chromosome 3p Kinase, 3pK) (Biotin)

Gene Names
MAPKAPK3; 3PK; MK-3; MAPKAP3; MAPKAP-K3; MAPKAPK-3
Reactivity
Human, Mouse
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MAPKAPK3; Monoclonal Antibody; MAPKAPK3 (Mitogen-activated Protein Kinase-activated Protein Kinase 3; MAP Kinase-activated Protein Kinase 3; MAPK-activated Protein Kinase 3; MAPKAP Kinase 3; MAPKAPK-3; Chromosome 3p Kinase; 3pK) (Biotin); anti-MAPKAPK3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B5
Specificity
Recognizes human MAPKAPK3. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-MAPKAPK3 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa272-382 from MAPKAPK3 (AAH01662) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EVSEDAKQLIRLLLKTDPTERLTITQFMNHPWINQSMVVPQTPLHTARVLQEDKDHWDEVKEEMTSALATMRVDYDQVKIKDLKTSNNRLLNKRRKKQAGSSSASQGCNNQ
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(MAPKAPK3 monoclonal antibody Western Blot analysis of MAPKAPK3 expression in HeLa.)

Western Blot (WB) (MAPKAPK3 monoclonal antibody Western Blot analysis of MAPKAPK3 expression in HeLa.)

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to MAPKAPK3 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to MAPKAPK3 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml])

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between MAPK13 and MAPKAPK3 HeLa cells were stained with MAPK13 rabbit purified polyclonal 1:1200 and MAPKAPK3 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between MAPK13 and MAPKAPK3 HeLa cells were stained with MAPK13 rabbit purified polyclonal 1:1200 and MAPKAPK3 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Product Categories/Family for anti-MAPKAPK3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
42,987 Da
NCBI Official Full Name
Homo sapiens mitogen-activated protein kinase-activated protein kinase 3, mRNA
NCBI Official Synonym Full Names
mitogen-activated protein kinase-activated protein kinase 3
NCBI Official Symbol
MAPKAPK3
NCBI Official Synonym Symbols
3PK; MK-3; MAPKAP3; MAPKAP-K3; MAPKAPK-3
NCBI Protein Information
MAP kinase-activated protein kinase 3

NCBI Description

This gene encodes a member of the Ser/Thr protein kinase family. This kinase functions as a mitogen-activated protein kinase (MAP kinase)- activated protein kinase. MAP kinases are also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals. This kinase was shown to be activated by growth inducers and stress stimulation of cells. In vitro studies demonstrated that ERK, p38 MAP kinase and Jun N-terminal kinase were all able to phosphorylate and activate this kinase, which suggested the role of this kinase as an integrative element of signaling in both mitogen and stress responses. This kinase was reported to interact with, phosphorylate and repress the activity of E47, which is a basic helix-loop-helix transcription factor known to be involved in the regulation of tissue-specific gene expression and cell differentiation. Alternate splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Sep 2011]

Research Articles on MAPKAPK3

Similar Products

Product Notes

The MAPKAPK3 (Catalog #AAA6142822) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MAPKAPK3 (Mitogen-activated Protein Kinase-activated Protein Kinase 3, MAP Kinase-activated Protein Kinase 3, MAPK-activated Protein Kinase 3, MAPKAP Kinase 3, MAPKAPK-3, Chromosome 3p Kinase, 3pK) (Biotin) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's MAPKAPK3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MAPKAPK3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MAPKAPK3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.