Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (MAPK3 monoclonal antibody (M05), clone 3D6. Western Blot analysis of MAPK3 expression in Hela S3 NE (Cat # L013V3).)

Mouse MAPK3 Monoclonal Antibody | anti-MAPK3 antibody

MAPK3 (Mitogen-Activated Protein Kinase 3, ERK1, HS44KDAP, HUMKER1A, MGC20180, P44ERK1, P44MAPK, PRKM3) (PE)

Gene Names
MAPK3; ERK1; ERT2; ERK-1; PRKM3; P44ERK1; P44MAPK; HS44KDAP; HUMKER1A; p44-ERK1; p44-MAPK
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified
Synonyms
MAPK3; Monoclonal Antibody; MAPK3 (Mitogen-Activated Protein Kinase 3; ERK1; HS44KDAP; HUMKER1A; MGC20180; P44ERK1; P44MAPK; PRKM3) (PE); Mitogen-Activated Protein Kinase 3; PRKM3; anti-MAPK3 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D6
Specificity
Recognizes MAPK3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
379
Applicable Applications for anti-MAPK3 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
MAPK3 (AAH13992, 279aa-379aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETARFQPGVLEAP
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(MAPK3 monoclonal antibody (M05), clone 3D6. Western Blot analysis of MAPK3 expression in Hela S3 NE (Cat # L013V3).)

Western Blot (WB) (MAPK3 monoclonal antibody (M05), clone 3D6. Western Blot analysis of MAPK3 expression in Hela S3 NE (Cat # L013V3).)

Western Blot (WB)

(MAPK3 monoclonal antibody (M05), clone 3D6. Western Blot analysis of MAPK3 expression in NIH/3T3.)

Western Blot (WB) (MAPK3 monoclonal antibody (M05), clone 3D6. Western Blot analysis of MAPK3 expression in NIH/3T3.)

Western Blot (WB)

(MAPK3 monoclonal antibody (M05), clone 3D6. Western Blot analysis of MAPK3 expression in PC-12.)

Western Blot (WB) (MAPK3 monoclonal antibody (M05), clone 3D6. Western Blot analysis of MAPK3 expression in PC-12.)

Western Blot (WB)

(MAPK3 monoclonal antibody (M05), clone 3D6. Western Blot analysis of MAPK3 expression in Raw 264.7.)

Western Blot (WB) (MAPK3 monoclonal antibody (M05), clone 3D6. Western Blot analysis of MAPK3 expression in Raw 264.7.)

Western Blot (WB)

(Western Blot analysis of MAPK3 expression in transfected 293T cell line by MAPK3 monoclonal antibody (M05), clone 3D6.Lane 1: MAPK3 transfected lysate (43.1 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MAPK3 expression in transfected 293T cell line by MAPK3 monoclonal antibody (M05), clone 3D6.Lane 1: MAPK3 transfected lysate (43.1 KDa).Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MAPK3 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to MAPK3 on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-MAPK3 antibody
The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act in a signaling cascade that regulates various cellular processes such as proliferation, differentiation, and cell cycle progression in response to a variety of extracellular signals. This kinase is activated by upstream kinases, resulting in its translocation to the nucleus where it phosphorylates nuclear targets. Alternatively spliced transcript variants encoding different protein isoforms have been described. [provided by RefSeq]
Product Categories/Family for anti-MAPK3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Mitogen-activated protein kinase 3
NCBI Official Synonym Full Names
mitogen-activated protein kinase 3
NCBI Official Symbol
MAPK3
NCBI Official Synonym Symbols
ERK1; ERT2; ERK-1; PRKM3; P44ERK1; P44MAPK; HS44KDAP; HUMKER1A; p44-ERK1; p44-MAPK
NCBI Protein Information
mitogen-activated protein kinase 3

NCBI Description

The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act in a signaling cascade that regulates various cellular processes such as proliferation, differentiation, and cell cycle progression in response to a variety of extracellular signals. This kinase is activated by upstream kinases, resulting in its translocation to the nucleus where it phosphorylates nuclear targets. Alternatively spliced transcript variants encoding different protein isoforms have been described. [provided by RefSeq, Jul 2008]

Research Articles on MAPK3

Similar Products

Product Notes

The MAPK3 (Catalog #AAA6186630) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's MAPK3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MAPK3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MAPK3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.