Mouse MAPK3 Monoclonal Antibody | anti-MAPK3 antibody

MAPK3 (Mitogen-Activated Protein Kinase 3, ERK1, HS44KDAP, HUMKER1A, MGC20180, P44ERK1, P44MAPK, PRKM3) (HRP)

Cat. Num. AAA6182058

• Gene Names: MAPK3; ERK1; ERT2; ERK-1; PRKM3; P44ERK1; P44MAPK; HS44KDAP; HUMKER1A; p44-ERK1; p44-MAPK
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: MAPK3; Monoclonal Antibody; MAPK3 (Mitogen-Activated Protein Kinase 3; ERK1; HS44KDAP; HUMKER1A; MGC20180; P44ERK1; P44MAPK; PRKM3) (HRP); Mitogen-Activated Protein Kinase 3; PRKM3; anti-MAPK3 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1F7
• Specificity: Recognizes MAPK3.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 379

• Applicable Applications for anti-MAPK3 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: MAPK3 (AAH13992, 279aa-379aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: NYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETARFQPGVLEAP
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(MAPK3 monoclonal antibody (M04), clone 1F7. Western Blot analysis of MAPK3 expression in Hela S3 NE (Cat # L013V3).)

Western Blot (WB)

(MAPK3 monoclonal antibody (M04), clone 1F7. Western Blot analysis of MAPK3 expression in NIH/3T3.)

Western Blot (WB)

(MAPK3 monoclonal antibody (M04), clone 1F7. Western Blot analysis of MAPK3 expression in PC-12.)

Western Blot (WB)

(MAPK3 monoclonal antibody (M04), clone 1F7. Western Blot analysis of MAPK3 expression in Raw 264.7.)

Western Blot (WB)

(Western Blot analysis of MAPK3 expression in transfected 293T cell line by MAPK3 monoclonal antibody (M04), clone 1F7.Lane 1: MAPK3 transfected lysate (43.1 KDa).Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MAPK3 on HeLa cell. [antibody concentration 10 ug/ml])

Product Categories/Family for anti-MAPK3 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 15559271
• NCBI GeneID: 5595
• NCBI Official Full Name: Mitogen-activated protein kinase 3
• NCBI Official Synonym Full Names: mitogen-activated protein kinase 3
• NCBI Official Symbol: MAPK3
• NCBI Official Synonym Symbols: ERK1; ERT2; ERK-1; PRKM3; P44ERK1; P44MAPK; HS44KDAP; HUMKER1A; p44-ERK1; p44-MAPK
• NCBI Protein Information: mitogen-activated protein kinase 3

NCBI Description

The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act in a signaling cascade that regulates various cellular processes such as proliferation, differentiation, and cell cycle progression in response to a variety of extracellular signals. This kinase is activated by upstream kinases, resulting in its translocation to the nucleus where it phosphorylates nuclear targets. Alternatively spliced transcript variants encoding different protein isoforms have been described. [provided by RefSeq, Jul 2008]