Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse anti-Human, Mouse MAP4K4 Monoclonal Antibody | anti-MAP4K4 antibody

MAP4K4 (Mitogen-activated Protein Kinase Kinase Kinase Kinase 4, HPK/GCK-like Kinase HGK, HGK, KIAA0687, MAPK/ERK Kinase Kinase Kinase 4, MEK Kinase Kinase 4, MEKKK 4, MEKKK4, Nck-interacting Kinase, NIK) (AP)

Gene Names
MAP4K4; HGK; NIK; MEKKK4; FLH21957; HEL-S-31
Reactivity
Human, Mouse
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MAP4K4; Monoclonal Antibody; MAP4K4 (Mitogen-activated Protein Kinase Kinase Kinase Kinase 4; HPK/GCK-like Kinase HGK; HGK; KIAA0687; MAPK/ERK Kinase Kinase Kinase 4; MEK Kinase Kinase 4; MEKKK 4; MEKKK4; Nck-interacting Kinase; NIK) (AP); anti-MAP4K4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4A5
Specificity
Recognizes human MAP4K4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
7658
Applicable Applications for anti-MAP4K4 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa611-710 from MAP4K4 (NP_663719) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VHPALQRPAEPQVQWSHLASLKNNVSPVSRSHSFSDPSPKFAHHHLRSQDPCPPSRSEVLSQSSDSKSEAPDPTQKAWSRSDSDEVPPRVPVRTTSRSPV
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(MAP4K4 monoclonal antibody Western Blot analysis of MAP4K4 expression in K-562)

Western Blot (WB) (MAP4K4 monoclonal antibody Western Blot analysis of MAP4K4 expression in K-562)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to MAP4K4 on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to MAP4K4 on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged MAP4K4 is ~0.03ng/ml as a capture antibody)

Testing Data (Detection limit for recombinant GST tagged MAP4K4 is ~0.03ng/ml as a capture antibody)
Product Categories/Family for anti-MAP4K4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
Homo sapiens mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), transcript variant 2, mRNA
NCBI Official Synonym Full Names
mitogen-activated protein kinase kinase kinase kinase 4
NCBI Official Symbol
MAP4K4
NCBI Official Synonym Symbols
HGK; NIK; MEKKK4; FLH21957; HEL-S-31
NCBI Protein Information
mitogen-activated protein kinase kinase kinase kinase 4

NCBI Description

The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase has been shown to specifically activate MAPK8/JNK. The activation of MAPK8 by this kinase is found to be inhibited by the dominant-negative mutants of MAP3K7/TAK1, MAP2K4/MKK4, and MAP2K7/MKK7, which suggests that this kinase may function through the MAP3K7-MAP2K4-MAP2K7 kinase cascade, and mediate the TNF-alpha signaling pathway. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Research Articles on MAP4K4

Similar Products

Product Notes

The MAP4K4 (Catalog #AAA6132205) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MAP4K4 (Mitogen-activated Protein Kinase Kinase Kinase Kinase 4, HPK/GCK-like Kinase HGK, HGK, KIAA0687, MAPK/ERK Kinase Kinase Kinase 4, MEK Kinase Kinase 4, MEKKK 4, MEKKK4, Nck-interacting Kinase, NIK) (AP) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's MAP4K4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MAP4K4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MAP4K4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.