Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of MAP4K1 expression in Jurkat using.)

Mouse MAP4K1 Monoclonal Antibody | anti-MAP4K1 antibody

MAP4K1 (Mitogen-Activated Protein Kinase Kinase Kinase Kinase 1, HPK1) (MaxLight 405)

Gene Names
MAP4K1; HPK1
Applications
Western Blot
Purity
Purified
Synonyms
MAP4K1; Monoclonal Antibody; MAP4K1 (Mitogen-Activated Protein Kinase Kinase Kinase Kinase 1; HPK1) (MaxLight 405); Mitogen-Activated Protein Kinase Kinase Kinase Kinase 1; HPK1; anti-MAP4K1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1G6
Specificity
Recognizes human MAP4K1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Sequence Length
833
Applicable Applications for anti-MAP4K1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa278-377 of human MAP4K1 (NP_009112) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GLNRGLILDLLDKLKNPGKGPSIGDIEDEEPELPPAIPRRIRSTHRSSSLGIPDADCCRRHMEFRKLRGMETRPPANTARLQPPRDLRSSSPRKQLSESS
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of MAP4K1 expression in Jurkat using.)

Western Blot (WB) (Western Blot analysis of MAP4K1 expression in Jurkat using.)

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Testing Data

(Detection limit for is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for is 0.03ng/ml as a capture antibody.)
Related Product Information for anti-MAP4K1 antibody
MaxLight405 is a new Violet photostable dye conjugate comparable to Alexa Fluor 405, PacificBlue, Brilliant Violet 421 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (400nm); Emission (423nm); Extinction Coefficient 32,000.
Product Categories/Family for anti-MAP4K1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
mitogen-activated protein kinase kinase kinase kinase 1 isoform 2
NCBI Official Synonym Full Names
mitogen-activated protein kinase kinase kinase kinase 1
NCBI Official Symbol
MAP4K1
NCBI Official Synonym Symbols
HPK1
NCBI Protein Information
mitogen-activated protein kinase kinase kinase kinase 1
UniProt Protein Name
Mitogen-activated protein kinase kinase kinase kinase 1
UniProt Gene Name
MAP4K1
UniProt Synonym Gene Names
HPK1; MEK kinase kinase 1; MEKKK 1
UniProt Entry Name
M4K1_HUMAN

Uniprot Description

HPK1: a protein kinase of the STE20 family. Expressed primarily in hematopoietic organs, including bone marrow, spleen and thymus. Also expressed at very low levels in lung, kidney, mammary glands and small intestine. May play a role in hematopoietic lineage decisions and growth regulation. Positively regulated by PGE2 and a negative regulator of PGE2-induced FOS gene transcription.

Protein type: EC 2.7.11.1; Protein kinase, STE; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; STE group; STE20 family; KHS subfamily

Chromosomal Location of Human Ortholog: 19q13.1-q13.4

Cellular Component: membrane; cytoplasm

Molecular Function: protein serine/threonine kinase activity; protein binding; MAP kinase kinase kinase kinase activity; ATP binding; protein kinase activity

Biological Process: cell proliferation; peptidyl-serine phosphorylation; protein amino acid autophosphorylation; activation of MAPKKK activity; response to stress; protein amino acid phosphorylation; activation of JNK activity

Research Articles on MAP4K1

Similar Products

Product Notes

The MAP4K1 map4k1 (Catalog #AAA6196591) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's MAP4K1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MAP4K1 map4k1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MAP4K1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.