Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Proximity Ligation Analysis of protein-protein interactions between MAP3K3 and MAP2K5 HeLa cells were stained with anti-MAP3K3 rabbit purified polyclonal 1:1200 and anti-MAP2K5 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Mouse MAP2K5 Monoclonal Antibody | anti-MAP2K5 antibody

MAP2K5 (Mitogen-Activated Protein Kinase Kinase 5, HsT17454, MAPKK5, MEK5, PRKMK5) (FITC)

Gene Names
MAP2K5; MEK5; MAPKK5; PRKMK5; HsT17454
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
MAP2K5; Monoclonal Antibody; MAP2K5 (Mitogen-Activated Protein Kinase Kinase 5; HsT17454; MAPKK5; MEK5; PRKMK5) (FITC); Mitogen-Activated Protein Kinase Kinase 5; PRKMK5; anti-MAP2K5 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
100000
Specificity
Recognizes MAP2K5.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
448
Applicable Applications for anti-MAP2K5 antibody
mmunofluorescence (IF), Western Blot (WB), In situ Proximity Ligation Assay (Cell)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
MAP2K5 (AAH08838, 1aa-120aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MLWLALGPFPAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAFEYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGL
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Proximity Ligation Analysis of protein-protein interactions between MAP3K3 and MAP2K5 HeLa cells were stained with anti-MAP3K3 rabbit purified polyclonal 1:1200 and anti-MAP2K5 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Testing Data (Proximity Ligation Analysis of protein-protein interactions between MAP3K3 and MAP2K5 HeLa cells were stained with anti-MAP3K3 rabbit purified polyclonal 1:1200 and anti-MAP2K5 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MAP2K5 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to MAP2K5 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MAP2K5 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to MAP2K5 on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-MAP2K5 antibody
The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase specifically interacts with and activates MAPK7/ERK5. This kinase itself can be phosphorylated and activated by MAP3K3/MEKK3, as well as by atypical protein kinase C isoforms (aPKCs). The signal cascade mediated by this kinase is involved in growth factor stimulated cell proliferation and muscle cell differentiation. Four alternatively spliced transcript variants of this gene encoding distinct isoforms have been described. [provided by RefSeq]
Product Categories/Family for anti-MAP2K5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Mitogen-activated protein kinase kinase 5
NCBI Official Synonym Full Names
mitogen-activated protein kinase kinase 5
NCBI Official Symbol
MAP2K5
NCBI Official Synonym Symbols
MEK5; MAPKK5; PRKMK5; HsT17454
NCBI Protein Information
dual specificity mitogen-activated protein kinase kinase 5

NCBI Description

The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase specifically interacts with and activates MAPK7/ERK5. This kinase itself can be phosphorylated and activated by MAP3K3/MEKK3, as well as by atypical protein kinase C isoforms (aPKCs). The signal cascade mediated by this kinase is involved in growth factor stimulated cell proliferation and muscle cell differentiation. Three alternatively spliced transcript variants of this gene encoding distinct isoforms have been described. [provided by RefSeq, May 2011]

Research Articles on MAP2K5

Similar Products

Product Notes

The MAP2K5 (Catalog #AAA6176275) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's MAP2K5 can be used in a range of immunoassay formats including, but not limited to, mmunofluorescence (IF), Western Blot (WB), In situ Proximity Ligation Assay (Cell). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MAP2K5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MAP2K5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.