Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged MAP1LC3B is ~0.03ng/ml as a capture antibody.)

Mouse anti-Human MAP1LC3B Monoclonal Antibody | anti-MAP1LC3B antibody

MAP1LC3B (Microtubule-associated Proteins 1A/1B Light Chain 3B, Autophagy-related Protein LC3 B, Autophagy-related Ubiquitin-like Modifier LC3 B, MAP1 Light Chain 3-like Protein 2, MAP1A/MAP1B Light Chain 3 B, MAP1A/MAP1B LC3 B, Microtubule-associated Pro

Gene Names
MAP1LC3B; LC3B; ATG8F; MAP1LC3B-a; MAP1A/1BLC3
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MAP1LC3B; Monoclonal Antibody; MAP1LC3B (Microtubule-associated Proteins 1A/1B Light Chain 3B; Autophagy-related Protein LC3 B; Autophagy-related Ubiquitin-like Modifier LC3 B; MAP1 Light Chain 3-like Protein 2; MAP1A/MAP1B Light Chain 3 B; MAP1A/MAP1B LC3 B; Microtubule-associated Pro; anti-MAP1LC3B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4E11
Specificity
Recognizes human MAP1LC3B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-MAP1LC3B antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa1-71 from human MAP1LC3B with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRL
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged MAP1LC3B is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MAP1LC3B is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-MAP1LC3B antibody
Microtubule-associated protein 1 light chain 3 (LC3) is a fibronectin mRNA-binding protein linked to mRNA translation. Three human isoforms of MAP1-LC3 have been cloned and characterized (MAP1- LC3A, -B, -C). These isoforms differ in their post-translation modification. MAP-LC3 proteins are related to cell growth, differentiation and migration in development and in diseases.
Product Categories/Family for anti-MAP1LC3B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted: 14 kDa

Observed: 14 kDa
NCBI Official Full Name
microtubule-associated proteins 1A/1B light chain 3B
NCBI Official Synonym Full Names
microtubule-associated protein 1 light chain 3 beta
NCBI Official Symbol
MAP1LC3B
NCBI Official Synonym Symbols
LC3B; ATG8F; MAP1LC3B-a; MAP1A/1BLC3
NCBI Protein Information
microtubule-associated proteins 1A/1B light chain 3B; MAP1A/MAP1B LC3 B; MAP1A/MAP1B light chain 3 B; MAP1 light chain 3-like protein 2; autophagy-related ubiquitin-like modifier LC3 B
UniProt Protein Name
Microtubule-associated proteins 1A/1B light chain 3B
UniProt Gene Name
MAP1LC3B
UniProt Synonym Gene Names
MAP1ALC3; MAP1A/MAP1B LC3 B
UniProt Entry Name
MLP3B_HUMAN

NCBI Description

The product of this gene is a subunit of neuronal microtubule-associated MAP1A and MAP1B proteins, which are involved in microtubule assembly and important for neurogenesis. Studies on the rat homolog implicate a role for this gene in autophagy, a process that involves the bulk degradation of cytoplasmic component. [provided by RefSeq, Jul 2008]

Research Articles on MAP1LC3B

Similar Products

Product Notes

The MAP1LC3B map1lc3b (Catalog #AAA6158710) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MAP1LC3B (Microtubule-associated Proteins 1A/1B Light Chain 3B, Autophagy-related Protein LC3 B, Autophagy-related Ubiquitin-like Modifier LC3 B, MAP1 Light Chain 3-like Protein 2, MAP1A/MAP1B Light Chain 3 B, MAP1A/MAP1B LC3 B, Microtubule-associated Pro reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAP1LC3B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MAP1LC3B map1lc3b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MAP1LC3B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.