Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human MAN1B1 Monoclonal Antibody | anti-MAN1B1 antibody

MAN1B1 (Endoplasmic Reticulum Mannosyl-oligosaccharide 1,2-alpha-mannosidase, ER alpha-1,2-Mannosidase, ER Mannosidase 1, ERMan1, Man9GlcNAc2-specific-processing alpha-mannosidase, Mannosidase alpha Class 1B Member 1, UNQ747/PRO1477) (PE)

Gene Names
MAN1B1; MRT15; ERMAN1; MANA-ER
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MAN1B1; Monoclonal Antibody; MAN1B1 (Endoplasmic Reticulum Mannosyl-oligosaccharide 1; 2-alpha-mannosidase; ER alpha-1; 2-Mannosidase; ER Mannosidase 1; ERMan1; Man9GlcNAc2-specific-processing alpha-mannosidase; Mannosidase alpha Class 1B Member 1; UNQ747/PRO1477) (PE); anti-MAN1B1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6B1
Specificity
Recognizes human MAN1B1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-MAN1B1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa112-212 from MAN1B1 (NP_057303) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AFRLEEEQKMRPEIAGLKPANPPVLPAPQKADTDPENLPEISSQKTQRHIQRGPPHLQIRPPSQDLKDGTQEEATKRQEAPVDPRPEGDPQRTVISWRGA*
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(MAN1B1 monoclonal antibody Western Blot analysis of MAN1B1 expression in HepG2.)

Western Blot (WB) (MAN1B1 monoclonal antibody Western Blot analysis of MAN1B1 expression in HepG2.)

Western Blot (WB)

(MAN1B1 monoclonal antibody Western Blot analysis of MAN1B1 expression in A-431.)

Western Blot (WB) (MAN1B1 monoclonal antibody Western Blot analysis of MAN1B1 expression in A-431.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to MAN1B1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to MAN1B1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged MAN1B1 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MAN1B1 is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(MAN1B1 monoclonal antibody Western Blot analysis of MAN1B1 expression in LNCaP.)

Western Blot (WB) (MAN1B1 monoclonal antibody Western Blot analysis of MAN1B1 expression in LNCaP.)
Product Categories/Family for anti-MAN1B1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
79,580 Da
NCBI Official Full Name
endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase
NCBI Official Synonym Full Names
mannosidase, alpha, class 1B, member 1
NCBI Official Symbol
MAN1B1
NCBI Official Synonym Symbols
MRT15; ERMAN1; MANA-ER
NCBI Protein Information
endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase; ER alpha 1,2-mannosidase; Man9GlcNAc2-specific processing alpha-mannosidase; endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase 1
UniProt Protein Name
Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase
UniProt Gene Name
MAN1B1
UniProt Synonym Gene Names
ERMan1
UniProt Entry Name
MA1B1_HUMAN

Uniprot Description

MAN1B1: Involved in glycoprotein quality control targeting of misfolded glycoproteins for degradation. It primarily trims a single alpha-1,2-linked mannose residue from Man(9)GlcNAc(2) to produce Man(8)GlcNAc(2), but at high enzyme concentrations, as found in the ER quality control compartment (ERQC), it further trims the carbohydrates to Man(5-6)GlcNAc(2). Defects in MAN1B1 are the cause of mental retardation autosomal recessive type 15 (MRT15). Mental retardation is characterized by significantly below average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. Belongs to the glycosyl hydrolase 47 family.

Protein type: Membrane protein, integral; EC 3.2.1.113; Hydrolase; Glycan Metabolism - N-glycan biosynthesis; Endoplasmic reticulum; Calcium-binding

Chromosomal Location of Human Ortholog: 9q34

Cellular Component: endoplasmic reticulum membrane; membrane; endoplasmic reticulum; integral to membrane; vesicle

Molecular Function: mannosyl-oligosaccharide 1,2-alpha-mannosidase activity; calcium ion binding

Biological Process: ER-associated protein catabolic process; cellular protein metabolic process; protein folding; protein amino acid N-linked glycosylation; protein amino acid N-linked glycosylation via asparagine; post-translational protein modification; oligosaccharide metabolic process

Disease: Mental Retardation, Autosomal Recessive 15

Similar Products

Product Notes

The MAN1B1 man1b1 (Catalog #AAA6158705) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MAN1B1 (Endoplasmic Reticulum Mannosyl-oligosaccharide 1,2-alpha-mannosidase, ER alpha-1,2-Mannosidase, ER Mannosidase 1, ERMan1, Man9GlcNAc2-specific-processing alpha-mannosidase, Mannosidase alpha Class 1B Member 1, UNQ747/PRO1477) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAN1B1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MAN1B1 man1b1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MAN1B1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.