Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human MAML2 Monoclonal Antibody | anti-MAML2 antibody

MAML2 (Mastermind-like Protein 2, Mam-2, KIAA1819, DKFZp686N0150, MGC176701, MLL-MAML2) (AP)

Gene Names
MAML2; MAM2; MAM3; MAM-3; MLL-MAML2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MAML2; Monoclonal Antibody; MAML2 (Mastermind-like Protein 2; Mam-2; KIAA1819; DKFZp686N0150; MGC176701; MLL-MAML2) (AP); anti-MAML2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4A1
Specificity
Recognizes human MAML2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
1156
Applicable Applications for anti-MAML2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa796-895 from human MAML2 (NP_115803) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RPPPDYKDQRRNVGNMQPTAQYSGGSSTISLNSNQALANPVSTHTILTPNSSLLSTSHGTRMPSLSTAVQNMGMYGNLPCNQPNTYSVTSGMNQLTQQR
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(MAML2 monoclonal antibody, Western Blot analysis of MAML2 expression in MCF-7.)

Western Blot (WB) (MAML2 monoclonal antibody, Western Blot analysis of MAML2 expression in MCF-7.)

Testing Data

(Detection limit for recombinant GST tagged MAML2 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MAML2 is ~1ng/ml as a capture antibody.)
Related Product Information for anti-MAML2 antibody
Acts as a transcriptional coactivator for NOTCH proteins. Has been shown to amplify NOTCH-induced transcription of HES1. Potentiates activation by NOTCH3 and NOTCH4 more efficiently than MAML1 or MAML3.
Product Categories/Family for anti-MAML2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
mastermind-like protein 2
NCBI Official Synonym Full Names
mastermind like transcriptional coactivator 2
NCBI Official Symbol
MAML2
NCBI Official Synonym Symbols
MAM2; MAM3; MAM-3; MLL-MAML2
NCBI Protein Information
mastermind-like protein 2
UniProt Protein Name
Mastermind-like protein 2
Protein Family
UniProt Gene Name
MAML2
UniProt Synonym Gene Names
KIAA1819
UniProt Entry Name
MAML2_HUMAN

NCBI Description

The protein encoded by this gene is a member of the Mastermind-like family of proteins. All family members are proline and glutamine-rich, and contain a conserved basic domain that binds the ankyrin repeat domain of the intracellular domain of the Notch receptors (ICN1-4) in their N-terminus, and a transcriptional activation domain in their C-terminus. This protein binds to an extended groove that is formed by the interaction of CBF1, Suppressor of Hairless, LAG-1 (CSL) with ICN, and positively regulates Notch signaling. High levels of expression of this gene have been observed in several B cell-derived lymphomas. Translocations resulting in fusion proteins with both CRTC1 and CRTC3 have been implicated in the development of mucoepidermoid carcinomas, while a translocation event with CXCR4 has been linked with chronic lymphocytic leukemia (CLL). Copy number variation in the polyglutamine tract has been observed. [provided by RefSeq, Jan 2015]

Research Articles on MAML2

Similar Products

Product Notes

The MAML2 maml2 (Catalog #AAA6132189) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MAML2 (Mastermind-like Protein 2, Mam-2, KIAA1819, DKFZp686N0150, MGC176701, MLL-MAML2) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAML2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MAML2 maml2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MAML2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.