Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (MAGOH monoclonal antibody (M02), clone 4H8 Western Blot analysis of MAGOH expression in Hela S3 NE.)

Mouse MAGOH Monoclonal Antibody | anti-MAGOH antibody

MAGOH (Mago-nashi Homolog, Proliferation-Associated (Drosophila), MAGOHA) (APC)

Gene Names
MAGOH; MAGOH1; MAGOHA
Applications
Western Blot
Purity
Purified
Synonyms
MAGOH; Monoclonal Antibody; MAGOH (Mago-nashi Homolog; Proliferation-Associated (Drosophila); MAGOHA) (APC); Mago-nashi Homolog; MAGOHA; anti-MAGOH antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4H8
Specificity
Recognizes MAGOH.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-MAGOH antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
MAGOH (NP_002361, 1aa-110aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDV
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(MAGOH monoclonal antibody (M02), clone 4H8 Western Blot analysis of MAGOH expression in Hela S3 NE.)

Western Blot (WB) (MAGOH monoclonal antibody (M02), clone 4H8 Western Blot analysis of MAGOH expression in Hela S3 NE.)

Western Blot (WB)

(Western Blot analysis of MAGOH expression in transfected 293T cell line by MAGOH monoclonal antibody (M02), clone 4H8.Lane 1: MAGOH transfected lysate(17.2 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MAGOH expression in transfected 293T cell line by MAGOH monoclonal antibody (M02), clone 4H8.Lane 1: MAGOH transfected lysate(17.2 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-MAGOH antibody
Drosophila that have mutations in their mago nashi (grandchildless) gene produce progeny with defects in germplasm assembly and germline development. This gene encodes the mammalian mago nashi homolog. In mammals, mRNA expression is not limited to the germ plasm, but is expressed ubiquitously in adult tissues and can be induced by serum stimulation of quiescent fibroblasts. [provided by RefSeq]
Product Categories/Family for anti-MAGOH antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18.2 kDa (154aa), confirmed by MALDI-TOF
NCBI Official Full Name
protein mago nashi homolog
NCBI Official Synonym Full Names
mago homolog, exon junction complex core component
NCBI Official Symbol
MAGOH
NCBI Official Synonym Symbols
MAGOH1; MAGOHA
NCBI Protein Information
protein mago nashi homolog
UniProt Protein Name
Protein mago nashi homolog
Protein Family
UniProt Gene Name
MAGOH
UniProt Synonym Gene Names
MAGOHA
UniProt Entry Name
MGN_HUMAN

NCBI Description

Drosophila that have mutations in their mago nashi (grandchildless) gene produce progeny with defects in germplasm assembly and germline development. This gene encodes the mammalian mago nashi homolog. In mammals, mRNA expression is not limited to the germ plasm, but is expressed ubiquitously in adult tissues and can be induced by serum stimulation of quiescent fibroblasts. [provided by RefSeq, Jul 2008]

Uniprot Description

MAGOH: Component of a splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junction on mRNAs. The EJC is a dynamic structure consisting of a few core proteins and several more peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. Core components of the EJC, that remains bound to spliced mRNAs throughout all stages of mRNA metabolism, functions to mark the position of the exon-exon junction in the mature mRNA and thereby influences downstream processes of gene expression including mRNA splicing, nuclear mRNA export, subcellular mRNA localization, translation efficiency and nonsense-mediated mRNA decay (NMD). Remains associated with the mRNA after its export to the cytoplasm and require translation of the mRNA for removal. The heterodimer MAGOH-RBM8A interacts with PYM that function to enhance the translation of EJC-bearing spliced mRNAs by recruiting them to the ribosomal 48S preinitiation complex. Belongs to the mago nashi family.

Protein type: RNA splicing; Spliceosome

Chromosomal Location of Human Ortholog: 1p32.3

Cellular Component: nucleoplasm; nuclear speck; nucleus; cytosol

Molecular Function: protein binding

Biological Process: regulation of translation; transcription from RNA polymerase II promoter; nuclear mRNA splicing, via spliceosome; mRNA export from nucleus; RNA splicing; mRNA catabolic process, nonsense-mediated decay; gene expression; mRNA 3'-end processing; termination of RNA polymerase II transcription; regulation of alternative nuclear mRNA splicing, via spliceosome

Research Articles on MAGOH

Similar Products

Product Notes

The MAGOH magoh (Catalog #AAA6166062) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's MAGOH can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MAGOH magoh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MAGOH, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.